Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.71
PubTator Score 4.17

Knowledge Summary

Patent (1,125)

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
lung cancer 1.100 1.4e-03
malignant mesothelioma -1.300 6.8e-07
Multiple myeloma 1.002 2.2e-02
non primary Sjogren syndrome sicca 1.300 1.8e-02
osteosarcoma -2.570 9.6e-08
ovarian cancer 1.300 2.1e-04
pancreatic cancer 1.100 2.4e-03
pancreatic carcinoma 1.100 2.4e-03
psoriasis -1.100 4.4e-08

Protein-protein Interaction (8)

Gene RIF (1)

AA Sequence

MLCSLLLCECLLLVAGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHK      1 - 70
LDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGDMHYDAEIILKRETLLEIQKF     71 - 140
LNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGVDPYNVLMVLLCLLCIVVLVATELWTYVRWY    141 - 210
TQLRRVLIISFLFSLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAKKMDWTGSIWEWFRSSWTYKDDPCQ    211 - 280
KYYELLLVNPIWLVPPTKALAVTFTTFVTEPLKHIGKGTGEFIKALMKEIPALLHLPVLIIMALAILSFC    281 - 350
YGAGKSVHVLRHIGGPESEPPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRR    351 - 420
EILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTES    421 - 490
SQSAKPVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDPVSSPCG             491 - 551
//

Text Mined References (22)

PMID Year Title