Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
Funding $1,294,682
PubMed Score 5.66
PubTator Score 4.17

Knowledge Summary

Patent (1,125)

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.100 0.002
Multiple myeloma 1.002 0.022
malignant mesothelioma -1.300 0.000
psoriasis -2.200 0.000
osteosarcoma -2.570 0.000
lung cancer 1.100 0.001
non primary Sjogren syndrome sicca 1.300 0.018
pancreatic carcinoma 1.100 0.002
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MLCSLLLCECLLLVAGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHK      1 - 70
LDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGDMHYDAEIILKRETLLEIQKF     71 - 140
LNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGVDPYNVLMVLLCLLCIVVLVATELWTYVRWY    141 - 210
TQLRRVLIISFLFSLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAKKMDWTGSIWEWFRSSWTYKDDPCQ    211 - 280
KYYELLLVNPIWLVPPTKALAVTFTTFVTEPLKHIGKGTGEFIKALMKEIPALLHLPVLIIMALAILSFC    281 - 350
YGAGKSVHVLRHIGGPESEPPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRR    351 - 420
EILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTES    421 - 490
SQSAKPVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDPVSSPCG             491 - 551
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...