Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.53
PubTator Score 1.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 5.5e-05
Breast cancer -1.700 1.3e-21
breast carcinoma -1.500 8.6e-36
cystic fibrosis 1.249 1.3e-04
cystic fibrosis and chronic rhinosinusit... 1.221 4.2e-02
ductal carcinoma in situ -1.400 1.8e-05
glioblastoma -1.300 3.7e-04
group 3 medulloblastoma 1.200 1.0e-04
invasive ductal carcinoma -2.200 3.9e-05
medulloblastoma, large-cell -1.200 1.6e-04
non primary Sjogren syndrome sicca -1.200 2.0e-02
oligodendroglioma 1.100 4.5e-02
osteosarcoma -1.301 1.1e-04
ovarian cancer -1.500 3.6e-12
pancreatic ductal adenocarcinoma liver m... -1.221 3.6e-03
psoriasis 1.900 5.1e-03
Rheumatoid arthritis 1.100 4.0e-02
tuberculosis and treatment for 3 months -1.100 4.3e-08

Gene RIF (3)

AA Sequence

MGSQTLQILRQGVWAALSGGWYYDPHQATFVNALHLYLWLFLLGLPFTLYMALPSTMIIVAVYCPVIAAV      1 - 70
FIVLKMVNYRLHRALDAGEVVDRTANEFTDQRTKAEQGNCSTRRKDSNGPSDPGGGIEMSEFIREATPPV     71 - 140
GCSSRNSYAGLDPSNQIGSGSSRLGTAATIKGDTDTAKTSDDISLSLGQSSSLCKEGSEEQDLAADRKLF    141 - 210
RLVSNDSFISIQPSLSSCGQDLPRDFSDKVNLPSHNHHHHVDQSLSSACDTEVASLVPLHSHSYRKDHRP    211 - 280
RGVPRTSSSAVAFPDTSLNDFPLYQQRRGLDPVSELESSKPLSGSKESLVENSGLSGEFQLAGDLKINTS    281 - 350
QPPTKSGKSKPLKAEKSMDSLRSLSTRSSGSTESYCSGTDRDTNSTVSSYKSEQTSSTHIESILSEHEES    351 - 420
PKAGTKSGRKKECCAGPEEKNSCASDKRTSSEKIAMEASTNSGVHEAKDPTPSDEMHNQRGLSTSASEEA    421 - 490
NKNPHANEFTSQGDRPPGNTAENKEEKSDKSAVSVDSKVRKDVGGKQKEGDVRPKSSSVIHRTASAHKSG    491 - 560
RRRTGKKRASSFDSSRHRDYVCFRGVSGTKPHSAIFCHDEDSSDQSDLSRASSVQSAHQFSSDSSSSTTS    561 - 630
HSCQSPEGRYSALKTKHTHKERGTDSEHTHKAHLVPEGTSKKRATRRTSSTNSAKTRARVLSLDSGTVAC    631 - 700
LNDSNRLMAPESIKPLTTSKSDLEAKEGEVLDELSLLGRASQLETVTRSRNSLPNQVAFPEGEEQDAVSG    701 - 770
AAQASEEAVSFRRERSTFRRQAVRRRHNAGSNPTPPTLLIGSPLSLQDGQQGQQSTAQVKVQSRPPSQAA    771 - 840
VLSASASLLVRNGSVHLEASHDNASAVGGSSLHDELGKFSSTLYETGGCDMSLVNFEPAARRASNICDTD    841 - 910
SHVSSSTSVRFYPHDVLSLPQIRLNRLLTIDTDLLEQQDIDLSPDLAATYGPTEEAAQKVKHYYRFWILP    911 - 980
QLWIGINFDRLTLLALFDRNREILENVLAVILAILVAFLGSILLIQGFFRDIWVFQFCLVIASCQYSLLK    981 - 1050
SVQPDSSSPRHGHNRIIAYSRPVYFCICCGLIWLLDYGSRNLTATKFKLYGITFTNPLVFISARDLVIVF   1051 - 1120
TLCFPIVFFIGLLPQVNTFVMYLCEQLDIHIFGGNATTSLLAALYSFICSIVAVALLYGLCYGALKDSWD   1121 - 1190
GQHIPVLFSIFCGLLVAVSYHLSRQSSDPSVLFSLVQSKIFPKTEEKNPEDPLSEVKDPLPEKLRNSVSE   1191 - 1260
RLQSDLVVCIVIGVLYFAIHVSTVFTVLQPALKYVLYTLVGFVGFVTHYVLPQVRKQLPWHCFSHPLLKT   1261 - 1330
LEYNQYEVRNAATMMWFEKLHVWLLFVEKNIIYPLIVLNELSSSAETIASPKKLNTELGALMITVAGLKL   1331 - 1400
LRSSFSSPTYQYVTVIFTVLFFKFDYEAFSETMLLDLFFMSILFNKLWELLYKLQFVYTYIAPWQITWGS   1401 - 1470
AFHAFAQPFAVPHSAMLFIQAAVSAFFSTPLNPFLGSAIFITSYVRPVKFWERDYNTKRVDHSNTRLASQ   1471 - 1540
LDRNPGSDDNNLNSIFYEHLTRSLQHSLCGDLLLGRWGNYSTGDCFILASDYLNALVHLIEIGNGLVTFQ   1541 - 1610
LRGLEFRGTYCQQREVEAITEGVEEDEGFCCCEPGHIPHMLSFNAAFSQRWLAWEVIVTKYILEGYSITD   1611 - 1680
NSAASMLQVFDLRKVLTTYYVKGIIYYVTTSSKLEEWLANETMQEGLRLCADRNYVDVDPTFNPNIDEDY   1681 - 1750
DHRLAGISRESFCVIYLNWIEYCSSRRAKPVDVDKDSSLVTLCYGLCVLGRRALGTASHHMSSNLESFLY   1751 - 1820
GLHALFKGDFRISSIRDEWIFADMELLRKVVVPGIRMSIKLHQDHFTSPDEYDDPTVLYEAIVSHEKNLV   1821 - 1890
IAHEGDPAWRSAVLANSPSLLALRHVMDDGTNEYKIIMLNRRYLSFRVIKVNKECVRGLWAGQQQELVFL   1891 - 1960
RNRNPERGSIQNAKQALRNMINSSCDQPIGYPIFVSPLTTSYSDSHEQLKDILGGPISLGNIRNFIVSTW   1961 - 2030
HRLRKGCGAGCNSGGNIEDSDTGGGTSCTGNNATTANNPHSNVTQGSIGNPGQGSGTGLHPPVTSYPPTL   2031 - 2100
GTSHSSHSVQSGLVRQSPARASVASQSSYCYSSRHSSLRMSTTGFVPCRRSSTSQISLRNLPSSIQSRLS   2101 - 2170
MVNQMEPSGQSGLACVQHGLPSSSSSSQSIPACKHHTLVGFLATEGGQSSATDAQPGNTLSPANNSHSRK   2171 - 2240
AEVIYRVQIVDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTR   2241 - 2310
SHIDKAVLLVQIDDKYVTVIETGVLELGAEV                                          2311 - 2341
//

Text Mined References (18)

PMID Year Title