Property Summary

NCBI Gene PubMed Count 34
Grant Count 54
R01 Count 45
Funding $7,361,787.08
PubMed Score 24.43
PubTator Score 16.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (22)

PMID Text
26738492 Data highlight the importance of the catalytic activity of PIMT to mediate VEGF effects during endothelial cell migration and tube formation in angiogenesis.
26074133 Self-association of Tgs1p and its catalytic activity were prerequisite to bypass the requirement for its accessory factor Swm2p for efficient pre-rRNA processing and snRNA trimethylation.
24330569 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
23922881 PIMT was identified as a key player responsible for glycated low density lipoproteins induced vascular endothelial cell apoptosis.
23754689 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21358275 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21204776 The protein L-isoaspartyl (D-aspartyl) methyltransferase (PIMT) is an enzyme that recognizes and repairs the abnormal L-isoaspartyl residues in proteins.
20679221 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
20679221 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
20679221 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
More...

AA Sequence

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCG      1 - 70
TAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQE     71 - 140
SWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLL    141 - 210
WQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEAD    211 - 280
DKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSE    281 - 350
VSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK    351 - 420
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKM    421 - 490
KNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGD    491 - 560
DLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKK    561 - 630
VNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCG    631 - 700
VGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPD    701 - 770
YATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA    771 - 840
YFGDLIRRPASET                                                             841 - 853
//

Text Mined References (41)

PMID Year Title
26738492 2016 The enzyme L-isoaspartyl (D-aspartyl) methyltransferase is required for VEGF-dependent endothelial cell migration and tubulogenesis.
26074133 2015 Self-association of Trimethylguanosine Synthase Tgs1 is required for efficient snRNA/snoRNA trimethylation and pre-rRNA processing.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
23922881 2013 PIMT prevents the apoptosis of endothelial cells in response to glycated low density lipoproteins and protective effects of grape seed procyanidin B2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21522132 2011 CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21204776 2011 Damaged proteins bearing L-isoaspartyl residues and aging: a dynamic equilibrium between generation of isomerized forms and repair by PIMT.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
More...