Property Summary

NCBI Gene PubMed Count 34
PubMed Score 24.43
PubTator Score 16.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.24523589229631E-10
pilocytic astrocytoma 3086 4.50817093215424E-8
malignant mesothelioma 3163 3.73449646716576E-7
pediatric high grade glioma 2712 1.1936084059773E-6
glioblastoma 5572 4.77710422928333E-6
medulloblastoma, large-cell 6234 1.95182896378665E-5
ovarian cancer 8492 2.40732887410911E-5
primitive neuroectodermal tumor 3031 1.82027829266525E-4
psoriasis 6685 3.77477425410366E-4
diabetes mellitus 1663 0.00403803827239182
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00549191674473853
osteosarcoma 7933 0.0108790412864072
Breast cancer 3099 0.0242437391459974
group 3 medulloblastoma 2254 0.0346448303658348
Disease Target Count Z-score Confidence
Muscular atrophy 67 3.577 1.8

Expression

  Differential Expression (14)

Synonym

Accession Q96RS0 A6NJQ5 Q5GH23 Q8TDG9 Q96QU3 Q9H5V3
Symbols PIMT
PIPMT
NCOA6IP

Gene

PDB

3EGI   3GDH  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (19)

PMID Text
26738492 Data highlight the importance of the catalytic activity of PIMT to mediate VEGF effects during endothelial cell migration and tube formation in angiogenesis.
26074133 Self-association of Tgs1p and its catalytic activity were prerequisite to bypass the requirement for its accessory factor Swm2p for efficient pre-rRNA processing and snRNA trimethylation.
24330569 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
23922881 PIMT was identified as a key player responsible for glycated low density lipoproteins induced vascular endothelial cell apoptosis.
23754689 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21358275 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
21204776 The protein L-isoaspartyl (D-aspartyl) methyltransferase (PIMT) is an enzyme that recognizes and repairs the abnormal L-isoaspartyl residues in proteins.
20679221 PIMT associates with Gag-Pol-RRE RNA in the presence of HIV-1 Rev, suggesting PIMT selectively modulates the expression of Rev/RRE-dependent RNAs
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCG      1 - 70
TAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQE     71 - 140
SWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLL    141 - 210
WQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEAD    211 - 280
DKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSE    281 - 350
VSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK    351 - 420
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKM    421 - 490
KNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGD    491 - 560
DLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKK    561 - 630
VNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCG    631 - 700
VGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPD    701 - 770
YATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA    771 - 840
YFGDLIRRPASET                                                             841 - 853
//

Text Mined References (41)

PMID Year Title
26738492 2016 The enzyme L-isoaspartyl (D-aspartyl) methyltransferase is required for VEGF-dependent endothelial cell migration and tubulogenesis.
26074133 2015 Self-association of Trimethylguanosine Synthase Tgs1 is required for efficient snRNA/snoRNA trimethylation and pre-rRNA processing.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
23922881 2013 PIMT prevents the apoptosis of endothelial cells in response to glycated low density lipoproteins and protective effects of grape seed procyanidin B2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21522132 2011 CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21204776 2011 Damaged proteins bearing L-isoaspartyl residues and aging: a dynamic equilibrium between generation of isomerized forms and repair by PIMT.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
More...