Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.53
PubTator Score 16.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.100 2.8e-05
Astrocytoma, Pilocytic 1.400 2.5e-08
atypical teratoid / rhabdoid tumor 1.900 6.2e-10
Breast cancer 2.900 2.4e-02
diabetes mellitus -1.200 4.0e-03
glioblastoma 1.300 9.5e-10
group 3 medulloblastoma 1.100 2.3e-03
intraductal papillary-mucinous carcinoma... 1.200 5.5e-03
malignant mesothelioma 1.900 3.7e-07
medulloblastoma, large-cell 1.500 2.0e-05
osteosarcoma -1.044 4.1e-03
ovarian cancer 1.900 2.4e-05
primitive neuroectodermal tumor 1.700 1.8e-04
psoriasis -1.200 5.8e-04

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCG      1 - 70
TAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQE     71 - 140
SWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLL    141 - 210
WQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEAD    211 - 280
DKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSE    281 - 350
VSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK    351 - 420
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKM    421 - 490
KNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGD    491 - 560
DLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKK    561 - 630
VNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCG    631 - 700
VGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPD    701 - 770
YATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA    771 - 840
YFGDLIRRPASET                                                             841 - 853
//

Text Mined References (41)

PMID Year Title