Property Summary

NCBI Gene PubMed Count 15
PubMed Score 622.34
PubTator Score 881.66

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 1.400 2.7e-03
Breast cancer 1.100 4.5e-05
breast carcinoma 1.500 2.4e-04
interstitial cystitis 1.500 7.1e-03
invasive ductal carcinoma 1.800 2.3e-03
lung adenocarcinoma 2.600 1.2e-10
non-small cell lung cancer 1.201 1.2e-10
ovarian cancer 1.400 3.4e-03
psoriasis 1.100 3.4e-36
tuberculosis -2.200 8.8e-07

Gene RIF (9)

AA Sequence

MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVA      1 - 70
GLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQ     71 - 140
YDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHT    141 - 210
LLEYLLGEGNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGL    211 - 280
VLLNAPVVAMTQGPHDVHVQIETSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYV    281 - 350
PATKVFLSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLAL    351 - 420
DDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAGEHTAYPHGWV    421 - 490
ETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHDLAKEEGSHPPVQGQLSLQNT    491 - 560
THTRTSH                                                                   561 - 567
//

Text Mined References (17)

PMID Year Title