Property Summary

NCBI Gene PubMed Count 14
Grant Count 32
R01 Count 13
Funding $4,281,796.76
PubMed Score 575.19
PubTator Score 881.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 1.400 0.003
tuberculosis and treatment for 3 months -2.300 0.000
non-small cell lung cancer 1.201 0.000
breast carcinoma 1.500 0.000
interstitial cystitis 1.500 0.007
psoriasis 2.600 0.000
lung adenocarcinoma 2.600 0.000
inflammatory breast cancer 2.100 0.024
invasive ductal carcinoma 1.800 0.002
ovarian cancer 1.400 0.003

Gene RIF (8)

PMID Text
25446972 The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
24307243 IL4I1 upregulation in human Th17 cells limits their TCR-mediated expansion not only by blocking the molecular pathway involved in the activation of the IL-2 promoter, but also by maintaining high levels of Tob1, which impairs entry into the cell cycle.
23355881 IL4I1 plays a distinct role compared to other antibacterial enzymes produced by mononuclear phagocytes.
20683900 participates in the downregulation of Th1 inflammation
19436310 strong IL4I1 expression is associated with B-cell lymphomas.
17356132 hIL4I1 inhibited the proliferation of CD3-stimulated T lymphocytes with a similar effect on CD4(+) and CD8(+) T cells. In contrast, memory T cells were more strongly affected by hIL4I1 and its catabolite H(2)O(2) than naive T cells
12446450 is activated in primary mediastinal large B-cell lymphoma, which might be due to a constitutive activation of a cytokine signaling pathway
12031486 genomic structure, cDNA sequence, chromosome location and RNA expression in immune tissues

AA Sequence

MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVA      1 - 70
GLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQ     71 - 140
YDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHT    141 - 210
LLEYLLGEGNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGL    211 - 280
VLLNAPVVAMTQGPHDVHVQIETSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYV    281 - 350
PATKVFLSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLAL    351 - 420
DDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWTVPYGRIYFAGEHTAYPHGWV    421 - 490
ETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHDLAKEEGSHPPVQGQLSLQNT    491 - 560
THTRTSH                                                                   561 - 567
//

Publication (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25446972 2015 Differential expression of the immunosuppressive enzyme IL4I1 in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
24307243 2014 IL-4-induced gene 1 maintains high Tob1 expression that contributes to TCR unresponsiveness in human T helper 17 cells.
23355881 2013 Antibacterial properties of the mammalian L-amino acid oxidase IL4I1.
20683900 2010 Dichotomy between factors inducing the immunosuppressive enzyme IL-4-induced gene 1 (IL4I1) in B lymphocytes and mononuclear phagocytes.
19436310 2009 The novel immunosuppressive enzyme IL4I1 is expressed by neoplastic cells of several B-cell lymphomas and by tumor-associated macrophages.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17356132 2007 Human IL4I1 is a secreted L-phenylalanine oxidase expressed by mature dendritic cells that inhibits T-lymphocyte proliferation.
16029492 2005 Alternative pre-mRNA processing regulates cell-type specific expression of the IL4l1 and NUP62 genes.
More...