Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.50
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acrocephalosyndactylia 17 4.812 2.4
Ptosis 48 3.399 1.7
Learning disability 17 3.039 1.5

Gene RIF (1)

AA Sequence

MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVD      1 - 70
QGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRI     71 - 140
ETLRLAIVYISFMTELLESCEKKESG                                                141 - 166
//

Text Mined References (10)

PMID Year Title