Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.71
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (1)

PMID Text
11472856 Identification and genomic structure of Nato3 in fly, mouse and man. Nervous system expression detected in fly and mouse.

AA Sequence

MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVD      1 - 70
QGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRI     71 - 140
ETLRLAIVYISFMTELLESCEKKESG                                                141 - 166
//

Publication (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
23756994 2013 Classification and evolutionary analysis of the basic helix-loop-helix gene family in the green anole lizard, Anolis carolinensis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217327 2002 N-twist, an evolutionarily conserved bHLH protein expressed in the developing CNS, functions as a transcriptional inhibitor.
11472856 2001 Nato3 is an evolutionarily conserved bHLH transcription factor expressed in the CNS of Drosophila and mouse.