Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent (245)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

AA Sequence

MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMYFFLSNLSWVD      1 - 70
ICFSTCIVPKMLVNIQTENKAISYMDCLTQVYFSMFFPILDTLLLTVMAYDRFVAVCHPLHYMIIMNPHL     71 - 140
CGLLVFVTWLIGVMTSLLHISLMMHLIFCKDFEIPHFFCELTYILQLACSDTFLNSTLIYFMTGVLGVFP    141 - 210
LLGIIFSYSRIASSIRKMSSSGGKQKALSTCGSHLSVVSLFYGTGIGVHFTSAVTHSSQKISVASVMYTV    211 - 280
VTPMLNPFIYSLRNKDVKGALGSLLSRAASCL                                          281 - 312
//

Publication (5)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
12175488 2002 A highly conserved novel family of mammalian developmental transcription factors related to Drosophila grainyhead.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.