Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.50

Knowledge Summary

Patent (245)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.200 2.7e-02
sonic hedgehog group medulloblastoma 1.100 4.1e-02

AA Sequence

MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMYFFLSNLSWVD      1 - 70
ICFSTCIVPKMLVNIQTENKAISYMDCLTQVYFSMFFPILDTLLLTVMAYDRFVAVCHPLHYMIIMNPHL     71 - 140
CGLLVFVTWLIGVMTSLLHISLMMHLIFCKDFEIPHFFCELTYILQLACSDTFLNSTLIYFMTGVLGVFP    141 - 210
LLGIIFSYSRIASSIRKMSSSGGKQKALSTCGSHLSVVSLFYGTGIGVHFTSAVTHSSQKISVASVMYTV    211 - 280
VTPMLNPFIYSLRNKDVKGALGSLLSRAASCL                                          281 - 312
//

Text Mined References (5)

PMID Year Title