Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.30
PubTator Score 0.58

Knowledge Summary

Patent (102)

TINX Plot

  Disease (2)

AA Sequence

MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFFLTHLSLIDTV      1 - 70
YSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDCYVAICKPLNYTTIMSHSLCI     71 - 140
LLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLYPLLKLVCIDTHTLGLFVAVNSGFICLLNFL    141 - 210
ILVVSYVIILRSLKNNSLEGRCKALSTCISHIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPML    211 - 280
NPVVYTLRNAEVKSAIRKLWRKKVTSDND                                             281 - 309
//

Text Mined References (5)

PMID Year Title