Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent (72)

AA Sequence

MANVTLVTGFLLMGFSNIQKLRILYGVLFLLIYLAALMSNLLIITLITLDVKLQTPMYFFLKNLSFLDVF      1 - 70
LVSVPIPKFIVNNLTHNNSISILGCAFQLLLMTSFSAGEIFILTAMSYDRYVAICCPLNYEVIMNTGVCV     71 - 140
LMASVSWAIGGLFGTAYTAGTFSMPFCGSSVIPQFFCDVPSLLRISCSETLMVIYAGIGVGACLSISCFI    141 - 210
CIVISYIYIFSTVLKIPTTKGQSKAFSTCFPHLTVFTVFIITAYFVYLKPPSNSPSVIDRLLSVIYTVMP    211 - 280
PVFNPVTYSLRNNDMKCALIRLLQKTYGQEAYFI                                        281 - 314
//

Text Mined References (3)

PMID Year Title