Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.18
PubTator Score 19.88

Knowledge Summary

Patent (199)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

AA Sequence

MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMYFLLSQLSLMD      1 - 70
LMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAYDRYVAICHPLQYTILMNPKL     71 - 140
CVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCDVAALLPLSCTETSAFERLLVICCVVMLIFP    141 - 210
VSVIILSYSHVLRAVIHMGSGESRRKAFTTCSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTI    211 - 280
LTPMLNPLIYSLRNKEVFRALQKVLKKRKLI                                           281 - 311
//

Text Mined References (5)

PMID Year Title