Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.18
PubTator Score 19.88

Knowledge Summary

Patent (199)

AA Sequence

MVWENQTFNSIFILLGIFNHSPTHTFLFSLVLGIFSLALMENISMVLLIYIEKQLHTPMYFLLSQLSLMD      1 - 70
LMLICTTLPKMIFSYLSGKKSISLAGCGTQIFFYVSLLGAECFLLAVMAYDRYVAICHPLQYTILMNPKL     71 - 140
CVFMTVASWTLGSLDGIIVLAAVLSFSYCSSLEIHHFFCDVAALLPLSCTETSAFERLLVICCVVMLIFP    141 - 210
VSVIILSYSHVLRAVIHMGSGESRRKAFTTCSSHLSVVGLYYGAAMFMYMRPASKHTPDQDKMVSAFYTI    211 - 280
LTPMLNPLIYSLRNKEVFRALQKVLKKRKLI                                           281 - 311
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.