Property Summary

NCBI Gene PubMed Count 30
PubMed Score 51.40
PubTator Score 33.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.484 1.1e-03
Atopic dermatitis 1.100 1.2e-04
Breast cancer 2.500 3.6e-02
breast carcinoma 1.500 7.0e-04
ductal carcinoma in situ 1.500 2.1e-02
Endometriosis 1.039 1.1e-02
group 3 medulloblastoma 2.300 1.3e-05
intraductal papillary-mucinous carcinoma... 1.100 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-03
invasive ductal carcinoma 1.800 6.6e-04
lung adenocarcinoma 1.200 7.7e-11
lung cancer 1.700 6.1e-04
malignant mesothelioma 1.700 3.4e-07
medulloblastoma, large-cell 1.200 2.5e-03
non-small cell lung cancer 2.484 9.5e-28
psoriasis 1.300 1.2e-97
tuberculosis -1.300 2.1e-06

 GO Function (1)

Gene RIF (20)

AA Sequence

MWRVKKLSLSLSPSPQTGKPSMRTPLRELTLQPGALTNSGKRSPACSSLTPSLCKLGLQEGSNNSSPVDF      1 - 70
VNNKRTDLSSEHFSHSSKWLETCQHESDEQPLDPIPQISSTPKTSEEAVDPLGNYMVKTIVLVPSPLGQQ     71 - 140
QDMIFEARLDTMAETNSISLNGPLRTDDLVREEVAPCMGDRFSEVAAVSEKPIFQESPSHLLEESPPNPC    141 - 210
SEQLHCSKESLSSRTEAVREDLVPSESNAFLPSSVLWLSPSTALAADFRVNHVDPEEEIVEHGAMEEREM    211 - 280
RFPTHPKESETEDQALVSSVEDILSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGV    281 - 350
NTSVMLENLRQSLSLPSMLRDAAIGTTPFSTCSVGTWFTPSAPQEKSTNTSQTGLVGTKHSTSETEQLLC    351 - 420
GRPPDLTALSRHDLEDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKLQHLKES    421 - 490
HEMGQALQQARNVMQSWVLISKELISLLHLSLLHLEEDKTTVSQESRRAETLVCCCFDLLKKLRAKLQSL    491 - 560
KAEREEARHREEMALRGKDAAEIVLEAFCAHASQRISQLEQDLASMREFRGLLKDAQTQLVGLHAKQEEL    561 - 630
VQQTVSLTSTLQQDWRSMQLDYTTWTALLSRSRQLTEKLTVKSQQALQERDVAIEEKQEVSRVLEQVSAQ    631 - 700
LEECKGQTEQLELENSRLATDLRAQLQILANMDSQLKELQSQHTHCAQDLAMKDELLCQLTQSNEEQAAQ    701 - 770
WQKEEMALKHMQAELQQQQAVLAKEVRDLKETLEFADQENQVAHLELGQVECQLKTTLEVLRERSLQCEN    771 - 840
LKDTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPT    841 - 910
QEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTEL    911 - 980
QSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQ    981 - 1050
QNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVD   1051 - 1120
KLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLE   1121 - 1190
FLS                                                                      1191 - 1193
//

Text Mined References (40)

PMID Year Title