Property Summary

NCBI Gene PubMed Count 24
Grant Count 7
R01 Count 5
Funding $302,404.84
PubMed Score 47.32
PubTator Score 33.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
27095104 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin have been reported.
25009111 Astrin acts as a mitotic phosphoprotein during the regulation of mitosis.
24853425 SPAG5 upregulation relates to poor prognosis in cervical cancer patients, and SPAG5 is a regulator of mTOR activity during taxol treatment in cervical cancer.
23953116 Study identifies astrin as an essential negative mTORC1 regulator in the cellular stress response. Upon stress, astrin inhibits mTORC1 association and recruits the mTORC1 component raptor to stress granules, thereby preventing mTORC1-hyperactivation-induced apoptosis.
22773063 The rsults of this study the increased expression of this gene may play a pathogenic role durin testicular development in subjects with DS and cryptorchidism.
22190034 HIV-1 gp41 is identified to have a physical interaction with sperm associated antigen 5 (SPAG5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20852589 Data show that CLASP1-astrin-Kif2b complex acts as a central switch at kinetochores that defines mitotic progression and promotes fidelity by temporally regulating kinetochore-microtuble attachments.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19197158 Results suggest that SNM1B/Apollo and Astrin function together to enforce the prophase checkpoint in response to spindle stress.
18361916 Astrin acts upstream of Aurora-A to regulate its mitotic spindle localization.
More...

AA Sequence

MWRVKKLSLSLSPSPQTGKPSMRTPLRELTLQPGALTNSGKRSPACSSLTPSLCKLGLQEGSNNSSPVDF      1 - 70
VNNKRTDLSSEHFSHSSKWLETCQHESDEQPLDPIPQISSTPKTSEEAVDPLGNYMVKTIVLVPSPLGQQ     71 - 140
QDMIFEARLDTMAETNSISLNGPLRTDDLVREEVAPCMGDRFSEVAAVSEKPIFQESPSHLLEESPPNPC    141 - 210
SEQLHCSKESLSSRTEAVREDLVPSESNAFLPSSVLWLSPSTALAADFRVNHVDPEEEIVEHGAMEEREM    211 - 280
RFPTHPKESETEDQALVSSVEDILSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGV    281 - 350
NTSVMLENLRQSLSLPSMLRDAAIGTTPFSTCSVGTWFTPSAPQEKSTNTSQTGLVGTKHSTSETEQLLC    351 - 420
GRPPDLTALSRHDLEDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKLQHLKES    421 - 490
HEMGQALQQARNVMQSWVLISKELISLLHLSLLHLEEDKTTVSQESRRAETLVCCCFDLLKKLRAKLQSL    491 - 560
KAEREEARHREEMALRGKDAAEIVLEAFCAHASQRISQLEQDLASMREFRGLLKDAQTQLVGLHAKQEEL    561 - 630
VQQTVSLTSTLQQDWRSMQLDYTTWTALLSRSRQLTEKLTVKSQQALQERDVAIEEKQEVSRVLEQVSAQ    631 - 700
LEECKGQTEQLELENSRLATDLRAQLQILANMDSQLKELQSQHTHCAQDLAMKDELLCQLTQSNEEQAAQ    701 - 770
WQKEEMALKHMQAELQQQQAVLAKEVRDLKETLEFADQENQVAHLELGQVECQLKTTLEVLRERSLQCEN    771 - 840
LKDTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPT    841 - 910
QEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTEL    911 - 980
QSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQ    981 - 1050
QNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVD   1051 - 1120
KLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLE   1121 - 1190
FLS                                                                      1191 - 1193
//

Publication (34)

PMID Year Title
27095104 2016 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25416956 2014 A proteome-scale map of the human interactome network.
25009111 2014 The mitosis-regulating and protein-protein interaction activities of astrin are controlled by aurora-A-induced phosphorylation.
24853425 2014 SPAG5 upregulation predicts poor prognosis in cervical cancer patients and alters sensitivity to taxol treatment via the mTOR signaling pathway.
24424245 2014 OSBP-related protein 8 (ORP8) interacts with Homo sapiens sperm associated antigen 5 (SPAG5) and mediates oxysterol interference of HepG2 cell cycle.
23953116 2013 Inhibition of mTORC1 by astrin and stress granules prevents apoptosis in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773063 2013 SPAG5 mRNA is over-expressed in peripheral blood leukocytes of patients with Down's syndrome and cryptorchidism.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
More...