Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.19
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (6)

AA Sequence

MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
SRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK              71 - 131
//

Text Mined References (35)

PMID Year Title