Property Summary

NCBI Gene PubMed Count 8
PubMed Score 195.23
PubTator Score 143.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.100 5.8e-06
inflammatory breast cancer -1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.300 2.1e-03
non-small cell lung cancer -1.101 5.1e-15
osteosarcoma -2.217 3.4e-06
ovarian cancer -1.300 2.6e-04
subependymal giant cell astrocytoma 1.839 2.6e-03
tuberculosis 1.900 6.3e-05

Synonym

Accession Q96QU6 B4E219 Q8WUL4 Q96LX5 ACC synthase-like protein 1
Symbols ACS
PHACS

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMI      1 - 70
KWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLF     71 - 140
LREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRL    141 - 210
AYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHR    211 - 280
LHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC    281 - 350
RYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL    351 - 420
PKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRP    421 - 490
SQSQEPSDQRR                                                               491 - 501
//

Text Mined References (11)

PMID Year Title