Property Summary

NCBI Gene PubMed Count 8
Grant Count 244
R01 Count 113
Funding $214,242,068
PubMed Score 166.26
PubTator Score 143.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q96QU6 B4E219 Q8WUL4 Q96LX5 ACC synthase-like protein 1
Symbols ACS
PHACS

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMI      1 - 70
KWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLF     71 - 140
LREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRL    141 - 210
AYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHR    211 - 280
LHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC    281 - 350
RYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL    351 - 420
PKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRP    421 - 490
SQSQEPSDQRR                                                               491 - 501
//

Publication (11)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...