Property Summary

NCBI Gene PubMed Count 18
Grant Count 17
R01 Count 16
Funding $1,222,226.2
PubMed Score 31.79
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24446247 Suggest dynamic interplay between transcriptional activators Pur-alpha/Pur-beta and repressors in regulating SMalphaA gene output during myofibroblast differentiation.
22174317 HIV-1 Rev interacting protein, purine-rich element binding protein B (PURB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PURB is increased by RRE
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19496623 findings offer insights into mechanism, energetics, and sequence of Purbeta repressor binding to a biologically relevant, contractile phenotype-regulating cis-element while revealing the thermodynamic confines of Purbeta-mediated effects on DNA structure
12933792 results show that PUR proteins are capable of binding to alpha-MHC mRNA and attenuate its translational efficiency; also show robust expression of PUR proteins in failing hearts where alpha-MHC mRNA levels are suppressed

AA Sequence

MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSK      1 - 70
SRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQR     71 - 140
GRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGG    141 - 210
PGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMK    211 - 280
EIQERQRDKLYERRGGGSGGGEESEGEEVDED                                          281 - 312
//

Text Mined References (28)

PMID Year Title
24446247 2014 The Pur?/Pur? single-strand DNA-binding proteins attenuate smooth-muscle actin gene transactivation in myofibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...