Property Summary

NCBI Gene PubMed Count 19
Grant Count 12
R01 Count 7
Funding $2,030,408.76
PubMed Score 10.13
PubTator Score 243.07

Knowledge Summary

Patent (3,994)

Expression

Gene RIF (7)

PMID Text
25326865 findings suggest that among genes in a gout-susceptibility locus, not ALPK1 but ABCG2 could be important as a gout-susceptible gene
23569188 single nucleotide polymorphisms in the alpha-protein kinase 1 (ALPK1) gene are associated with gout in Han Chinese Taiwanese.
23539754 ALPK1 may be a susceptibility gene for chronic kidney disease in such individuals with diabetes mellitus.
21822924 ALPK1 is a gout-susceptible gene involved in Monosodium urate monohydrate-induced inflammatory responses and may contribute to the development of gout by enhancing the inflammatory responses via the MAP kinase pathway
21208416 Transposon-inserted Alpk1 homozygous mutant mice display severe defects in motor coordination in a series of behavioral analyses.
20332099 Observational study of gene-disease association. (HuGE Navigator)
15883161 the phosphorylation of myosin I by ALPK1 is an essential process in the apical trafficking of raft-associated sucrose-isomaltase

AA Sequence

MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQ      1 - 70
AVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPA     71 - 140
TPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMW    141 - 210
YEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAE    211 - 280
ACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQE    281 - 350
LHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQ    351 - 420
VQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCI    421 - 490
TALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWTHSDAFRVSLDQDVETETEPS    491 - 560
DYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVDTQCSTALSEELE    561 - 630
NDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQE    631 - 700
VRNMGPRNTSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEIS    701 - 770
ERGAGPTFKASPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVA    771 - 840
EQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPVLSEDCTTTEE    841 - 910
GNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPDDF    911 - 980
EKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAF    981 - 1050
WVHHLHQEEILGRYVGKDYKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILE   1051 - 1120
DKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLI   1121 - 1190
YLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT                   1191 - 1244
//

Publication (21)

PMID Year Title
25326865 2015 Common variant of ALPK1 is not associated with gout: a replication study.
23569188 2013 ALPK1 genetic regulation and risk in relation to gout.
23539754 2013 Identification of chromosome 3q28 and ALPK1 as susceptibility loci for chronic kidney disease in Japanese individuals by a genome-wide association study.
22484627 2012 A genome-wide association meta-analysis identifies new childhood obesity loci.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21822924 2011 Lymphocyte ?-kinase is a gout-susceptible gene involved in monosodium urate monohydrate-induced inflammatory responses.
21799462 2011 Genome-wide association study of epirubicin-induced leukopenia in Japanese patients.
21208416 2011 Motor coordination deficits in Alpk1 mutant mice with the inserted piggyBac transposon.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...