Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.46
PubTator Score 243.07

Knowledge Summary

Patent (3,994)

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma 2.000 1.8e-02
ependymoma 1.200 4.8e-08
intraductal papillary-mucinous adenoma (... 1.200 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.800 1.0e-03
lung carcinoma -2.500 4.7e-43
osteosarcoma -1.935 4.8e-05
ovarian cancer -1.300 9.5e-09
pancreatic ductal adenocarcinoma liver m... 1.466 2.7e-03
subependymal giant cell astrocytoma 1.650 1.2e-02
tuberculosis 1.100 1.5e-05

Gene RIF (8)

AA Sequence

MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQ      1 - 70
AVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPA     71 - 140
TPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMW    141 - 210
YEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAE    211 - 280
ACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQE    281 - 350
LHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQ    351 - 420
VQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCI    421 - 490
TALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWTHSDAFRVSLDQDVETETEPS    491 - 560
DYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVDTQCSTALSEELE    561 - 630
NDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQE    631 - 700
VRNMGPRNTSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEIS    701 - 770
ERGAGPTFKASPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVA    771 - 840
EQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPVLSEDCTTTEE    841 - 910
GNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPDDF    911 - 980
EKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAF    981 - 1050
WVHHLHQEEILGRYVGKDYKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILE   1051 - 1120
DKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLI   1121 - 1190
YLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT                   1191 - 1244
//

Text Mined References (22)

PMID Year Title