Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.3378640678963E-11
non-small cell lung cancer 2798 1.23649135170684E-7
ulcerative colitis 2087 1.34094626058614E-6
acute quadriplegic myopathy 1157 5.46635941145177E-6
osteosarcoma 7933 1.27724269595313E-5
pituitary cancer 1972 1.79073997485047E-5
cystic fibrosis 1670 2.14409444172631E-5
atypical teratoid / rhabdoid tumor 4369 7.62408751387799E-5
ovarian cancer 8492 1.86224392257682E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 4.60051774325495E-4
Pick disease 1893 0.00120290729497397
group 4 medulloblastoma 1875 0.00146845566953785
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00360017351468932
medulloblastoma, large-cell 6234 0.0132908616196687
aldosterone-producing adenoma 664 0.0244962485684645
Breast cancer 3099 0.0250450794678322
invasive ductal carcinoma 2950 0.0301402084777834
ependymoma 2514 0.0385062249309214
oligodendroglioma 2849 0.0395526748877355
spina bifida 1064 0.048537721837307

Expression

  Differential Expression (20)

Synonym

Accession Q96QK8
Symbols C4orf34

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
24499674 hC4orf34 is an endoplasmic reticulum-resident type I transmembrane protein.

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLL      1 - 70
RPPNLRGSSLPGKPTSPHNGQDPPAPPVD                                              71 - 99
//

Text Mined References (7)

PMID Year Title
24499674 2014 Characterization of the cellular localization of C4orf34 as a novel endoplasmic reticulum resident protein.
23759569 2013 MISP: The missing link between extracellular matrix and astral microtubules.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.