Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q96QK8
Symbols C4orf34

Gene

Gene RIF (1)

PMID Text
24499674 hC4orf34 is an endoplasmic reticulum-resident type I transmembrane protein.

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLL      1 - 70
RPPNLRGSSLPGKPTSPHNGQDPPAPPVD                                              71 - 99
//

Publication (7)

PMID Year Title
24499674 2014 Characterization of the cellular localization of C4orf34 as a novel endoplasmic reticulum resident protein.
23759569 2013 MISP: The missing link between extracellular matrix and astral microtubules.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.