Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.345 5.5e-06
aldosterone-producing adenoma -1.359 2.4e-02
atypical teratoid / rhabdoid tumor -1.100 7.6e-05
Breast cancer 4.000 2.5e-02
cystic fibrosis -1.032 1.0e-04
ependymoma -1.100 3.9e-02
group 4 medulloblastoma 1.300 1.5e-03
intraductal papillary-mucinous adenoma (... 1.200 1.7e-02
invasive ductal carcinoma 1.100 3.0e-02
juvenile dermatomyositis 1.365 1.3e-11
medulloblastoma, large-cell -2.200 1.3e-02
non-small cell lung cancer -1.034 1.2e-07
oligodendroglioma -1.100 4.0e-02
osteosarcoma 2.957 1.3e-05
ovarian cancer -1.200 1.6e-03
pancreatic ductal adenocarcinoma liver m... -2.325 4.6e-04
Pick disease 1.300 1.2e-03
pituitary cancer -1.500 1.8e-05
spina bifida -2.023 4.9e-02
ulcerative colitis -1.300 1.3e-06

Synonym

Accession Q96QK8
Symbols C4orf34

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLL      1 - 70
RPPNLRGSSLPGKPTSPHNGQDPPAPPVD                                              71 - 99
//

Text Mined References (8)

PMID Year Title