Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.81
PubTator Score 6.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 9.8e-05
astrocytic glioma -1.400 1.1e-02
Astrocytoma, Pilocytic -1.100 1.3e-04
atypical teratoid / rhabdoid tumor -1.600 3.2e-06
colon cancer -1.300 1.3e-02
ependymoma -1.600 1.7e-02
glioblastoma -1.200 6.5e-05
medulloblastoma -1.300 4.1e-05
medulloblastoma, large-cell -1.800 2.1e-04
oligodendroglioma -1.100 2.4e-02
ovarian cancer -1.200 1.3e-05

Synonym

Accession Q96QG7 B7Z291 Q52LU3 Q8WW11 Q96QG6 Q9NX50
Symbols MTMR8
C8orf9
LIP-STYX

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (2)

Protein-protein Interaction (10)

Gene RIF (7)

AA Sequence

MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTII      1 - 70
IKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSAT     71 - 140
SEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTN    141 - 210
GRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIK    211 - 280
LVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQII    281 - 350
LEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN    351 - 420
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWPSVAPQS    421 - 490
LPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELETEDGMQESP               491 - 549
//

Text Mined References (33)

PMID Year Title