Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
R01 Count 7
Funding $1,280,638.36
PubMed Score 6.80
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.011
posterior fossa group B ependymoma -1.800 0.000
oligodendroglioma -1.100 0.024
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.800 0.000
colon cancer -1.300 0.013
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.200 0.000

Gene RIF (7)

PMID Text
24937802 Polymorphism of rs2293855 in MTMR9 is associated with measures of glucose tolerance, indices of insulin secretion and indices of insulin sensitivity.
24591580 MTMR6, which dephosphorylates PI(3)P to PI, and its binding partner MTMR9, are required for macropinocytosis.
21796137 Our data suggest that genetic variations in the FTO, SCG3 and MTMR9 genes independently influence the risk of metabolic syndrome.
20712903 Observational study of gene-disease association. (HuGE Navigator)
19038970 MTMR9 greatly enhances the functions of MTMR6
17855449 Association of single-nucleotide polymorphisms in MTMR9 gene with obesity.
17855449 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTII      1 - 70
IKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSAT     71 - 140
SEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTN    141 - 210
GRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIK    211 - 280
LVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQII    281 - 350
LEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN    351 - 420
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWPSVAPQS    421 - 490
LPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELETEDGMQESP               491 - 549
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24937802 2014 The MTMR9 rs2293855 polymorphism is associated with glucose tolerance, insulin secretion, insulin sensitivity and increased risk of prediabetes.
24591580 2014 Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21796137 2011 Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...