Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.80
PubTator Score 6.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.29790529999425E-10
atypical teratoid / rhabdoid tumor 4369 3.0500083009128E-7
ovarian cancer 8492 1.32818557104174E-5
medulloblastoma 1524 4.08003744677954E-5
adult high grade glioma 2148 8.33056917048368E-5
pilocytic astrocytoma 3086 1.21109567200282E-4
glioblastoma 5572 1.55383177016517E-4
medulloblastoma, large-cell 6234 2.05597075730003E-4
astrocytic glioma 2241 0.0105210066028025
colon cancer 1475 0.0127950131843674
oligodendroglioma 2849 0.0244070143256076

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.011
posterior fossa group B ependymoma -1.800 0.000
oligodendroglioma -1.100 0.024
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.800 0.000
colon cancer -1.300 0.013
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q96QG7 B7Z291 Q52LU3 Q8WW11 Q96QG6 Q9NX50
Symbols MTMR8
C8orf9
LIP-STYX

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
24937802 Polymorphism of rs2293855 in MTMR9 is associated with measures of glucose tolerance, indices of insulin secretion and indices of insulin sensitivity.
24591580 MTMR6, which dephosphorylates PI(3)P to PI, and its binding partner MTMR9, are required for macropinocytosis.
21796137 Our data suggest that genetic variations in the FTO, SCG3 and MTMR9 genes independently influence the risk of metabolic syndrome.
20712903 Observational study of gene-disease association. (HuGE Navigator)
19038970 MTMR9 greatly enhances the functions of MTMR6
17855449 Association of single-nucleotide polymorphisms in MTMR9 gene with obesity.
17855449 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTII      1 - 70
IKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSAT     71 - 140
SEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTN    141 - 210
GRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIK    211 - 280
LVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQII    281 - 350
LEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN    351 - 420
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWPSVAPQS    421 - 490
LPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELETEDGMQESP               491 - 549
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24937802 2014 The MTMR9 rs2293855 polymorphism is associated with glucose tolerance, insulin secretion, insulin sensitivity and increased risk of prediabetes.
24591580 2014 Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21796137 2011 Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...