Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.46
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.2001516003066E-8
medulloblastoma, large-cell 6234 1.17736006742248E-4
atypical teratoid / rhabdoid tumor 4369 0.00108179474097045
group 4 medulloblastoma 1875 0.00330663043955906
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0117815759311864
ovarian cancer 8492 0.0122656992853609
pancreatic cancer 2300 0.0154919503129772
pancreatic carcinoma 567 0.0154919503129772
Breast cancer 3099 0.0215510499526643
pancreatic ductal adenocarcinoma liver metastasis 1795 0.042040253328144
Disease Target Count Z-score Confidence
Chagas disease 34 3.048 1.5

Expression

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19836239 FYTTD1 was named UIF for UAP56 Interacting Factor. UIF is an mRNA export adaptor, recruited to mRNA by SSRP1 of the FACT complex. It also binds mRNA and NXF1. It is required for efficient nuclear export of mRNA in vertebrates and other animals.

AA Sequence

MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRV      1 - 70
RWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRK     71 - 140
ANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLD    141 - 210
DVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDI    211 - 280
NSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG                                    281 - 318
//

Text Mined References (21)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
19836239 2009 UIF, a New mRNA export adaptor that works together with REF/ALY, requires FACT for recruitment to mRNA.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...