Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.46
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.1e-03
Breast cancer 3.500 2.2e-02
group 4 medulloblastoma 1.200 3.3e-03
intraductal papillary-mucinous carcinoma... -1.200 1.2e-02
medulloblastoma, large-cell 1.400 1.2e-04
osteosarcoma 3.097 1.8e-09
ovarian cancer 1.500 1.2e-02
pancreatic cancer -1.200 1.5e-02
pancreatic carcinoma -1.200 1.5e-02
pancreatic ductal adenocarcinoma liver m... -1.107 4.2e-02

Gene RIF (1)

AA Sequence

MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRV      1 - 70
RWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRK     71 - 140
ANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLD    141 - 210
DVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDI    211 - 280
NSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG                                    281 - 318
//

Text Mined References (22)

PMID Year Title