Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.67
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.900 1.4e-02
ependymoma -1.900 2.5e-02
oligodendroglioma -1.400 4.1e-02
glioblastoma -2.000 1.4e-06
osteosarcoma -2.166 3.9e-05
cystic fibrosis -1.642 2.9e-05
atypical teratoid / rhabdoid tumor -2.400 1.1e-06
medulloblastoma, large-cell -1.300 5.4e-03
primitive neuroectodermal tumor -1.500 5.5e-04
tuberculosis and treatment for 6 months 1.300 5.8e-06
adult high grade glioma -1.800 3.6e-05
sonic hedgehog group medulloblastoma -1.700 1.6e-04
pilocytic astrocytoma -1.300 4.2e-06
subependymal giant cell astrocytoma -1.369 2.7e-02
spina bifida -1.376 4.5e-02
acute myeloid leukemia 1.200 3.9e-02
ovarian cancer -2.100 1.4e-17

Synonym

Accession Q96QA6 A0PK16 A2RUG4 Q65ZA0 Q8N3W2
Symbols FKSG4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19107206 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD                          71 - 119
//

Text Mined References (9)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19107206 2008 Distinct genetic loci control plasma HIV-RNA and cellular HIV-DNA levels in HIV-1 infection: the ANRS Genome Wide Association 01 study.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.