Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.67
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.900 0.014
ependymoma -1.900 0.025
oligodendroglioma -1.400 0.041
glioblastoma -2.000 0.000
osteosarcoma -2.166 0.000
cystic fibrosis -1.642 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.300 0.005
primitive neuroectodermal tumor -1.500 0.001
tuberculosis and treatment for 6 months 1.300 0.000
adult high grade glioma -1.800 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -1.369 0.027
spina bifida -1.376 0.045
acute myeloid leukemia 1.200 0.039
ovarian cancer -2.100 0.000

Gene RIF (3)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19107206 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD                          71 - 119
//

Publication (9)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19107206 2008 Distinct genetic loci control plasma HIV-RNA and cellular HIV-DNA levels in HIV-1 infection: the ANRS Genome Wide Association 01 study.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.