Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.69
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.8e-43
Disease Target Count Z-score Confidence
Asthma 385 3.678 1.8
Hemolytic anemia 77 0.0 3.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 3.604 1.8
Alopecia 115 3.456 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.8e-43

Gene RIF (11)

AA Sequence

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP      1 - 70
SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFL     71 - 140
KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL    141 - 210
MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS    211 - 280
SLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL    281 - 350
VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW    351 - 420
DPDTLPRLCALYAGLSLLQQLTKAS                                                 421 - 445
//

Text Mined References (27)

PMID Year Title