Property Summary

NCBI Gene PubMed Count 4
Grant Count 13
R01 Count 8
Funding $1,712,708.17
PubMed Score 13.94
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22779914 CIB3, as binding partners for the integrin alphaIIb subunit, which suggests that they are potentially involved in regulating integrin alphaIIb subunit activation.

AA Sequence

MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPF      1 - 70
RQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDYICAWDLEQTVTKLTRGGL     71 - 140
SAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFLSTFHIRI                           141 - 187
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22779914 2012 Biophysical and structural studies of the human calcium- and integrin-binding protein family: understanding their functional similarities and differences.
15574431 2005 Structural and biochemical characterization of CIB1 delineates a new family of EF-hand-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.