Property Summary

NCBI Gene PubMed Count 4
PubMed Score 14.14
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPF      1 - 70
RQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDYICAWDLEQTVTKLTRGGL     71 - 140
SAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFLSTFHIRI                           141 - 187
//

Text Mined References (6)

PMID Year Title