Property Summary

NCBI Gene PubMed Count 24
Grant Count 15
R01 Count 9
Funding $868,963.24
PubMed Score 27.41
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (9)

PMID Text
26537633 Using ASB2 conditional knockout mice.
24052262 data therefore reveal ubiquitin acceptor sites in FLNa and establish that ASB2alpha-mediated effects on cell spreading are due to loss of filamins.
24044920 Phosphorylation of serine 323 of ASB2 alpha by Erk kinases is critical for ASB2alpha-mediated degradation of FLNA.
22916308 Data show that neither endogenous nor exogenously expressed ASB2alpha induces degradation of JAK proteins in hematopoietic cells
22382022 These results suggest that ASB2beta but not ASB2alpha might be monoubiquitinated and that the ASB2beta UIM motif, but not its E3 Ub ligase activity, plays a pivotal role in this monoubiquitination.
22174154 A model whereby ASB2 contributes to hematopoietic differentiation, in part, through MLL degradation and HOX gene down-regulation.
21737450 ASB2alpha is a novel regulator of integrin-dependent adhesion of hematopoietic cells
21119685 By shifting monomeric E3 ligase complexes to dimeric forms through activation of Asb2 transcription, Notch could effectively control the turnover of a variety of substrates and it exerts diverse effects on cell proliferation and differentiation.
18799729 ASB2 may regulate hematopoietic cell differentiation by modulating cell spreading and actin remodeling through targeting of filamins A and B for degradation.

AA Sequence

MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADPLIKAIKDGDE      1 - 70
EALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQRTLQEETAVYLATCRGHLDCL     71 - 140
LSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHNADTNHRCNRGWTALHESVSRNDLEVMQILV    141 - 210
SGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKYGADINTQASDNASALYEACKNEHEEVVEFLLSQGA    211 - 280
DANKTNKDGLLPLHIASKKGNYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTP    281 - 350
LAPERARLYEDRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANID    351 - 420
AYIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVV    421 - 490
QFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLCRLRVRKAI    491 - 560
GKYRIKLLDTLPLPGRLIRYLKYENTQ                                               561 - 587
//

Text Mined References (27)

PMID Year Title
26537633 2015 Substrates of the ASB2? E3 ubiquitin ligase in dendritic cells.
24052262 2013 ASB2?, an E3 ubiquitin ligase specificity subunit, regulates cell spreading and triggers proteasomal degradation of filamins by targeting the filamin calponin homology 1 domain.
24044920 2013 Phosphorylation of serine 323 of ASB2? is pivotal for the targeting of filamin A to degradation.
22916308 2012 Filamins but not Janus kinases are substrates of the ASB2? cullin-ring E3 ubiquitin ligase in hematopoietic cells.
22382022 2012 The ASB2? Ubiquitin-interacting motif is involved in its monoubiquitination.
22174154 2012 ECSASB2 mediates MLL degradation during hematopoietic differentiation.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21737450 2011 Functional and structural insights into ASB2alpha, a novel regulator of integrin-dependent adhesion of hematopoietic cells.
21119685 2011 Notch-induced Asb2 expression promotes protein ubiquitination by forming non-canonical E3 ligase complexes.
19376791 2009 A label-free quantitative proteomics strategy to identify E3 ubiquitin ligase substrates targeted to proteasome degradation.
More...