Property Summary

NCBI Gene PubMed Count 24
PubMed Score 27.67
PubTator Score 16.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy -1.514 3.2e-05
autosomal dominant Emery-Dreifuss muscul... -1.064 8.2e-03
Duchenne muscular dystrophy -1.417 6.1e-08
group 4 medulloblastoma -1.100 3.1e-04
juvenile dermatomyositis -1.064 3.7e-07
tuberculosis -2.300 1.1e-05

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (9)

AA Sequence

MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADPLIKAIKDGDE      1 - 70
EALKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQRTLQEETAVYLATCRGHLDCL     71 - 140
LSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHNADTNHRCNRGWTALHESVSRNDLEVMQILV    141 - 210
SGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKYGADINTQASDNASALYEACKNEHEEVVEFLLSQGA    211 - 280
DANKTNKDGLLPLHIASKKGNYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTP    281 - 350
LAPERARLYEDRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANID    351 - 420
AYIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVV    421 - 490
QFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLCRLRVRKAI    491 - 560
GKYRIKLLDTLPLPGRLIRYLKYENTQ                                               561 - 587
//

Text Mined References (27)

PMID Year Title