Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.300 7.0e-04
atypical teratoid / rhabdoid tumor -3.200 4.1e-05
Duchenne muscular dystrophy -1.166 1.5e-07
ductal carcinoma in situ -1.900 1.7e-03
ependymoma -2.300 1.4e-10
glioblastoma -1.500 1.7e-04
lung carcinoma 1.300 2.9e-17
medulloblastoma -1.500 1.1e-03
medulloblastoma, large-cell 1.400 1.0e-04
osteosarcoma 2.391 2.3e-10
ovarian cancer 1.500 3.9e-13
pituitary cancer 2.200 4.6e-08
tuberculosis 1.700 2.5e-05

Gene RIF (5)

AA Sequence

MGALTSRQHAGVEEVDIPSNSVYRYPPKSGSYFASHFIMGGEKFDSTHPEGYLFGENSDLNFLGNRPVVF      1 - 70
PYAAPPPQEPVKTLRSLVNIRKDTLRLVKCAEEVKSPGEEASKAKVHYNVEFTFDTDARVAITIYYQATE     71 - 140
EFQNGIASYIPKDNSLQSETVQYKRGVCQQFCLPSHTVDPSEWAEEELGFDLDREVYPLVVHAVVDEGDE    141 - 210
YFGHCHVLLGTFEKHTDGTFCVKPLKQKQVVDGVSYLLQEIYGIENKYNTQDSKVAEDEVSDNSAECVVC    211 - 280
LSDVRDTLILPCRHLCLCNTCADTLRYQANNCPICRLPFRALLQIRAMRKKLGPLSPTSFNPIISSQTSD    281 - 350
SEEHPSSENIPPGYEVVSLLEALNGPLTPSPAVPPLHVLGDGHLSGMLPSYGSDGHLPPVRTISPLDRLS    351 - 420
DSSSQGLKLKKSLSKSTSQNSSVLHEEEDEHSCSESETQLSQRPSVQHLGEECGVTPESENLTLSSSGAI    421 - 490
DQSSCTGTPLSSTISSPEGPASSSLAQSVMSMASSQISTDTVSSMSGSYIAPGTEEEGEALSSPQPASRA    491 - 560
PSEEGEGLPAESPDSNFAGLPAGEQDAEGNDVIEEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALD    561 - 630
NKLCSEVCLPGAWQADDNAVSRNAQRRRLSSSSLEDSETRPCVWGPLAV                         631 - 679
//

Text Mined References (12)

PMID Year Title