Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
Funding $1,097,972
PubMed Score 4.09
PubTator Score 2.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.631 0.000

Gene RIF (3)

PMID Text
23096689 Two alternative splice variants of ODF3 and ODF4, were found.
18976975 Knockdown of outer dense fiber of sperm tails 3 (ODF3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
11870087 cloning and sequence analysis of h-shippo 1 an orthologue of mouse shippo 1

AA Sequence

MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY      1 - 70
NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA     71 - 140
AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG    141 - 210
DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE                              211 - 254
//

Text Mined References (8)

PMID Year Title
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23096689 2012 Expression of splice variants of cancer-testis genes ODF3 and ODF4 in the testis of a prostate cancer patient.
21460842 2011 A genome-wide association study identifies three loci associated with susceptibility to uterine fibroids.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11870087 2002 Molecular cloning and characterization of a complementary DNA encoding sperm tail protein SHIPPO 1.