Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.81
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Asthma 349
Cocaine-Related Disorders 88
Disease Target Count P-value
lung carcinoma 2844 6.78087602070234E-11
juvenile dermatomyositis 1189 4.22915580300848E-8
ulcerative colitis 2087 2.48092926655753E-7
tuberculosis 1563 2.05965024833223E-6
medulloblastoma, large-cell 6234 5.76849207791576E-5
interstitial cystitis 2299 7.85501475104944E-5
sonic hedgehog group medulloblastoma 1482 8.33521665067595E-5
primary Sjogren syndrome 789 1.79877342773444E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0108211634150755
active Crohn's disease 918 0.0181444455892284
ovarian cancer 8492 0.0214993627913672
pancreatic cancer 2300 0.023328785868951
gastric carcinoma 832 0.0246862396467846
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0363746477384361

Expression

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
14672410 Data report a novel splicing variant of KLHL5, named KLHL5b, and describe its expression pattern in many tissues.

AA Sequence

MNVIYFPLHIFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQILKIRWRWFGHQ      1 - 70
ASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEVPAFE     71 - 140
FTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQTLSSCHTMEPCTSDEFFQALNHAEQTFKKM    141 - 210
ENYLRHKQLCDVILVAGDRRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYT    211 - 280
GRLELKEDNIECLLSTACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFM    281 - 350
EVIRNQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLA    351 - 420
DMENNVLFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGMDSTKGATSIEKYDLR    421 - 490
TNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLE    491 - 560
GPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDP    561 - 630
HTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDA    631 - 700
VGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL                   701 - 755
//

Text Mined References (9)

PMID Year Title
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
21294900 2011 A genome-wide association study of serum uric acid in African Americans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672410 2003 Characterization of a novel splicing variant of KLHL5, a member of the kelch protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590829 2001 Cloning and characterization of KLHL5, a novel human gene encoding a kelch-related protein with a BTB domain.