Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.81
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.181 1.8e-02
gastric carcinoma 1.300 2.5e-02
interstitial cystitis 1.400 3.9e-04
intraductal papillary-mucinous adenoma (... -2.100 1.1e-02
juvenile dermatomyositis 1.069 4.2e-08
lung carcinoma -1.300 6.8e-11
medulloblastoma -1.300 7.2e-04
medulloblastoma, large-cell -3.000 5.8e-05
ovarian cancer 1.400 2.1e-02
pancreatic cancer 1.200 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.382 3.6e-02
primary Sjogren syndrome 1.300 1.8e-04
tuberculosis -1.100 2.1e-06
ulcerative colitis 3.500 2.5e-07

Gene RIF (1)

AA Sequence

MNVIYFPLHIFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQILKIRWRWFGHQ      1 - 70
ASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEVPAFE     71 - 140
FTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQTLSSCHTMEPCTSDEFFQALNHAEQTFKKM    141 - 210
ENYLRHKQLCDVILVAGDRRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYT    211 - 280
GRLELKEDNIECLLSTACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFM    281 - 350
EVIRNQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLA    351 - 420
DMENNVLFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGMDSTKGATSIEKYDLR    421 - 490
TNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLE    491 - 560
GPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDP    561 - 630
HTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDA    631 - 700
VGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL                   701 - 755
//

Text Mined References (9)

PMID Year Title