Property Summary

NCBI Gene PubMed Count 32
PubMed Score 113.73
PubTator Score 23.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 7.910046137233E-9
tuberculosis and treatment for 6 months 686 3.65024599680305E-5
medulloblastoma, large-cell 6234 5.69899291619467E-5
psoriasis 6685 1.04890367265655E-4
COPD 116 0.00118929091171668
atypical teratoid / rhabdoid tumor 4369 0.0024713045724363
ependymoma 2514 0.00515536647918119
oligodendroglioma 2849 0.0051581144089598
glioblastoma 5572 0.00572714872921007
medulloblastoma 1524 0.00686377843385523
astrocytic glioma 2241 0.0130530946647078
Disease Target Count Z-score Confidence
Farber lipogranulomatosis 9 3.4 1.7
Kennedy's disease 13 3.28 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 0.013
ependymoma 1.800 0.005
oligodendroglioma 1.600 0.005
psoriasis -2.000 0.000
osteosarcoma -2.425 0.000
atypical teratoid / rhabdoid tumor 1.300 0.002
glioblastoma 1.100 0.006
medulloblastoma 1.300 0.007
medulloblastoma, large-cell 1.900 0.000
tuberculosis and treatment for 6 months -1.600 0.000
COPD -1.300 0.001

Synonym

Accession Q96PK6 B0LM41 B3KMN4 D6RGD8 O75932 Q2PYN1 Q53GV1 Q68DQ9 Q96PK5
Symbols SIP
COAA
PSP2
SYTIP1
TMEM137

Gene

PDB

2DNP  

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (15)

PMID Text
26283796 RBM14 connects key paraspeckle subcomplexes via interactions mediated by its prion-like domain.
25589658 This study identifies a cellular protein named RBM14 that is associated with XPO1 (CRM1), a nuclear protein that binds to the HIV-1 Rev protein and mediates nuclear export of incompletely spliced HIV-1 viral RNAs
25589658 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25496916 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25385835 upon RBM14 depletion, a part of the ectopic centriolar protein complexes in turn assemble into structures more akin to centrioles, presumably by incorporating HsSAS-6, a cartwheel component, and cause multipolar spindle formation.
24811242 RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation.
21736557 CoAA is involved in the migration-enhancing action of PEA3 on MCF7 metastatic human cancer cells.
19585539 CoAA binds Runx2 and prevents Runx2 binding to DNA; CoAA is expressed at high levels in human fetal osteoblasts and osteosarcoma cell lines
19416963 The alternative splicing imbalance of CoAA and RBM4, because of loss of their common enhancer in cancer, may deregulate stem/progenitor cell differentiation
18829545 CoAA is a potential tumor suppressor in renal carcinoma and CoAM is a counterbalancing splice isoform.
More...

AA Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEM      1 - 70
SRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGK     71 - 140
RINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFF    141 - 210
GRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVS    211 - 280
LGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGA    281 - 350
QAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ    351 - 420
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQS    421 - 490
AAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLS    491 - 560
MSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTK    561 - 630
SSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM                                   631 - 669
//

Text Mined References (49)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26283796 2015 Prion-like domains in RNA binding proteins are essential for building subnuclear paraspeckles.
25589658 2015 Mining the human complexome database identifies RBM14 as an XPO1-associated protein involved in HIV-1 Rev function.
25385835 2015 RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24811242 2014 RNA binding protein RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...