Tbio | RNA-binding protein 14 |
Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1 (PubMed:11443112). Regulates centriole biogenesis by suppressing the formation of aberrant centriolar protein complexes in the cytoplasm and thus preserving mitotic spindle integrity. Prevents the formation of the STIL-CENPJ complex (which can induce the formation of aberrant centriolar protein complexes) by interfering with the interaction of STIL with CENPJ (PubMed:25385835).
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 7.910046137233E-9 |
tuberculosis and treatment for 6 months | 686 | 3.65024599680305E-5 |
medulloblastoma, large-cell | 6234 | 5.69899291619467E-5 |
psoriasis | 6685 | 1.04890367265655E-4 |
COPD | 116 | 0.00118929091171668 |
atypical teratoid / rhabdoid tumor | 4369 | 0.0024713045724363 |
ependymoma | 2514 | 0.00515536647918119 |
oligodendroglioma | 2849 | 0.0051581144089598 |
glioblastoma | 5572 | 0.00572714872921007 |
medulloblastoma | 1524 | 0.00686377843385523 |
astrocytic glioma | 2241 | 0.0130530946647078 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Farber lipogranulomatosis | 9 | 3.4 | 1.7 |
Kennedy's disease | 13 | 3.28 | 1.6 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | 1.100 | 0.013 |
ependymoma | 1.800 | 0.005 |
oligodendroglioma | 1.600 | 0.005 |
psoriasis | -2.000 | 0.000 |
osteosarcoma | -2.425 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.300 | 0.002 |
glioblastoma | 1.100 | 0.006 |
medulloblastoma | 1.300 | 0.007 |
medulloblastoma, large-cell | 1.900 | 0.000 |
tuberculosis and treatment for 6 months | -1.600 | 0.000 |
COPD | -1.300 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26283796 | RBM14 connects key paraspeckle subcomplexes via interactions mediated by its prion-like domain. |
25589658 | This study identifies a cellular protein named RBM14 that is associated with XPO1 (CRM1), a nuclear protein that binds to the HIV-1 Rev protein and mediates nuclear export of incompletely spliced HIV-1 viral RNAs |
25589658 | The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells |
25496916 | The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells |
25385835 | upon RBM14 depletion, a part of the ectopic centriolar protein complexes in turn assemble into structures more akin to centrioles, presumably by incorporating HsSAS-6, a cartwheel component, and cause multipolar spindle formation. |
24811242 | RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation. |
21736557 | CoAA is involved in the migration-enhancing action of PEA3 on MCF7 metastatic human cancer cells. |
19585539 | CoAA binds Runx2 and prevents Runx2 binding to DNA; CoAA is expressed at high levels in human fetal osteoblasts and osteosarcoma cell lines |
19416963 | The alternative splicing imbalance of CoAA and RBM4, because of loss of their common enhancer in cancer, may deregulate stem/progenitor cell differentiation |
18829545 | CoAA is a potential tumor suppressor in renal carcinoma and CoAM is a counterbalancing splice isoform. |
More... |
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEM 1 - 70 SRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGK 71 - 140 RINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFF 141 - 210 GRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVS 211 - 280 LGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGA 281 - 350 QAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ 351 - 420 QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQS 421 - 490 AAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLS 491 - 560 MSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTK 561 - 630 SSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM 631 - 669 //
PMID | Year | Title |
---|---|---|
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26283796 | 2015 | Prion-like domains in RNA binding proteins are essential for building subnuclear paraspeckles. |
25589658 | 2015 | Mining the human complexome database identifies RBM14 as an XPO1-associated protein involved in HIV-1 Rev function. |
25385835 | 2015 | RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity. |
25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
24811242 | 2014 | RNA binding protein RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
More... |