Property Summary

NCBI Gene PubMed Count 33
PubMed Score 124.66
PubTator Score 23.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.300 2.5e-03
COPD -1.300 1.2e-03
ependymoma 1.800 5.2e-03
glioblastoma 1.100 5.7e-03
group 4 medulloblastoma 1.300 8.1e-03
medulloblastoma, large-cell 1.900 5.7e-05
oligodendroglioma 1.600 5.2e-03
osteosarcoma 1.167 2.7e-03
psoriasis -2.000 1.0e-04
tuberculosis and treatment for 3 months -1.200 3.5e-04

Gene RIF (15)

AA Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEM      1 - 70
SRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGK     71 - 140
RINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFF    141 - 210
GRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVS    211 - 280
LGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGA    281 - 350
QAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ    351 - 420
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQS    421 - 490
AAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLS    491 - 560
MSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTK    561 - 630
SSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM                                   631 - 669
//

Text Mined References (51)

PMID Year Title