Property Summary

NCBI Gene PubMed Count 32
Grant Count 14
R01 Count 10
Funding $1,188,829.51
PubMed Score 113.73
PubTator Score 23.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 0.013
ependymoma 1.800 0.005
oligodendroglioma 1.600 0.005
psoriasis -2.000 0.000
osteosarcoma -2.425 0.000
atypical teratoid / rhabdoid tumor 1.300 0.002
glioblastoma 1.100 0.006
medulloblastoma 1.300 0.007
medulloblastoma, large-cell 1.900 0.000
tuberculosis and treatment for 6 months -1.600 0.000
COPD -1.300 0.001

Gene RIF (18)

PMID Text
26283796 RBM14 connects key paraspeckle subcomplexes via interactions mediated by its prion-like domain.
25589658 This study identifies a cellular protein named RBM14 that is associated with XPO1 (CRM1), a nuclear protein that binds to the HIV-1 Rev protein and mediates nuclear export of incompletely spliced HIV-1 viral RNAs
25589658 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25589658 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25589658 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25589658 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25496916 The localization of RBM14 to the nuclear paraspeckles is required for RBM14 enhancement of HIV-1 Rev activity in cells
25385835 upon RBM14 depletion, a part of the ectopic centriolar protein complexes in turn assemble into structures more akin to centrioles, presumably by incorporating HsSAS-6, a cartwheel component, and cause multipolar spindle formation.
24811242 RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation.
21736557 CoAA is involved in the migration-enhancing action of PEA3 on MCF7 metastatic human cancer cells.
More...

AA Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEM      1 - 70
SRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGK     71 - 140
RINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFF    141 - 210
GRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVS    211 - 280
LGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGA    281 - 350
QAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ    351 - 420
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQS    421 - 490
AAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLS    491 - 560
MSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTK    561 - 630
SSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM                                   631 - 669
//

Text Mined References (49)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26283796 2015 Prion-like domains in RNA binding proteins are essential for building subnuclear paraspeckles.
25589658 2015 Mining the human complexome database identifies RBM14 as an XPO1-associated protein involved in HIV-1 Rev function.
25385835 2015 RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24811242 2014 RNA binding protein RBM14 promotes radio-resistance in glioblastoma by regulating DNA repair and cell differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...