Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.49
PubTator Score 8.66

Knowledge Summary

Patent (2,038)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Male infertility 170 4.115 2.1
Infertility 163 3.576 1.8

Synonym

Accession Q96PF2 Q8IY55 TSK-2
Symbols TSK2
DGS-G
SPOGA2
STK22B

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
23258646 Report evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein testis-specific serine kinase 2 (TSSK2)
19926886 associated with male idiopathic infertility
19926886 Observational study of gene-disease association. (HuGE Navigator)
15044604 Data show that human testis-specific serine/threonine (Ser/Thr) kinase (TSSK) 1 and 2 messages are expressed exclusively in the testis and suggest that this family of kinases might play a role in sperm function.

AA Sequence

MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG      1 - 70
SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE     71 - 140
NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT    211 - 280
SSASFKREGEGKYRAECKLDTKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG    281 - 350
AEVGKAST                                                                  351 - 358
//

Text Mined References (16)

PMID Year Title
23258646 2013 Evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20729278 2011 Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
19926886 Some single-nucleotide polymorphisms of the TSSK2 gene may be associated with human spermatogenesis impairment.
18533145 2008 Targeted deletion of Tssk1 and 2 causes male infertility due to haploinsufficiency.
18495105 2008 TSKS concentrates in spermatid centrioles during flagellogenesis.
17566264 2007 Validation of a testis specific serine/threonine kinase [TSSK] family and the substrate of TSSK1 & 2, TSKS, as contraceptive targets.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...