Property Summary

NCBI Gene PubMed Count 13
Grant Count 27
R01 Count 18
Funding $1,756,875.57
PubMed Score 11.49
PubTator Score 8.66

Knowledge Summary

Patent (2,038)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Male infertility 170 4.115 2.1
Infertility 163 3.576 1.8

Gene RIF (5)

PMID Text
23258646 Report evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
23047923 In vitro protein-protein interaction analysis identifies a Vpu-binding host protein testis-specific serine kinase 2 (TSSK2)
19926886 associated with male idiopathic infertility
19926886 Observational study of gene-disease association. (HuGE Navigator)
15044604 Data show that human testis-specific serine/threonine (Ser/Thr) kinase (TSSK) 1 and 2 messages are expressed exclusively in the testis and suggest that this family of kinases might play a role in sperm function.

AA Sequence

MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG      1 - 70
SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE     71 - 140
NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV    141 - 210
CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT    211 - 280
SSASFKREGEGKYRAECKLDTKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG    281 - 350
AEVGKAST                                                                  351 - 358
//

Text Mined References (16)

PMID Year Title
23258646 2013 Evolution of testis-specific kinases TSSK1B and TSSK2 in primates.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20729278 2011 Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
19926886 Some single-nucleotide polymorphisms of the TSSK2 gene may be associated with human spermatogenesis impairment.
18533145 2008 Targeted deletion of Tssk1 and 2 causes male infertility due to haploinsufficiency.
18495105 2008 TSKS concentrates in spermatid centrioles during flagellogenesis.
17566264 2007 Validation of a testis specific serine/threonine kinase [TSSK] family and the substrate of TSSK1 & 2, TSKS, as contraceptive targets.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...