Property Summary

NCBI Gene PubMed Count 137
Grant Count 137
R01 Count 55
Funding $12,031,695.31
PubMed Score 317.68
PubTator Score 907.80

Knowledge Summary

Patent

No data available

Synonym

Accession Q96PD4 Q6NSI0 Q7Z6P4 Q96PI8 Q9NUE6 IL-17F
Symbols ML1
ML-1
CANDF6
IL-17F

Gene

PDB

1JPY   3JVF  

Gene RIF (139)

PMID Text
26667835 IL17F and IL17RA polymorphisms modulate susceptibility to cerebral malaria (CM) and provide evidence that IL-17F protects against CM.
26558270 A G/G genotype of rs766748 in IL-17F, and a C/C or C/A genotype of rs1883136 in TRAF3IP2.
26515887 The GGAGAA combined genotype and the GGA haplotype of IL-17A rs2275913, IL-17F rs763780 and rs2397084 can be considered risk factors for the development of systemic lupus erythematosus in Egyptian children.
26505366 No evidence of the association was observed between rs3748067, rs3819025, rs763780, rs9382084, and rs1266828 polymorphisms and the risk of cervical cancer.
26478573 higher expression level in chronic lymphocytic leukemia patients
26467330 Interleukin-17F gene polymorphism and its elevated serum levels are associated with recurrent pregnancy loss.
26464720 Genotyping of IL-17A rs2275913 and rs3748067 and IL-17F rs763780 genes was performed by multiplex PCR assays
26451724 data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of preeclampsia in Chinese Han women.
26447633 GA genotype of the rs11465553 IL17F gene polymorphism may be associated with a significantly higher risk of graft function loss and return to dialysis after kidney transplantation.
26445528 Review/Meta-analysis: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer.
More...

AA Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSM      1 - 70
SRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS     71 - 140
FQLEKVLVTVGCTCVTPVIHHVQ                                                   141 - 163
//

Text Mined References (140)

PMID Year Title
26667835 2015 The IL17F and IL17RA Genetic Variants Increase Risk of Cerebral Malaria in Two African Populations.
26558270 2015 Genetic Polymorphisms of IL-17F and TRAF3IP2 Could Be Predictive Factors of the Long-Term Effect of Infliximab against Crohn's Disease.
26515887 2016 Interleukin-17A rs2275913, Interleukin-17F rs763780 and rs2397084 gene polymorphisms as possible risk factors in Juvenile lupus and lupus related nephritis.
26505366 2015 Association analysis of IL-17A and IL-17F polymorphisms in Chinese women with cervical cancer.
26478573 2015 Identification and characterization of distinct IL-17F expression patterns and signaling pathways in chronic lymphocytic leukemia and normal B lymphocytes.
26467330 2015 Interleukin-17 and leptin genes polymorphisms and their levels in relation to recurrent pregnancy loss in Egyptian females.
26464720 2015 Association between interluekin-17 gene polymorphisms and the risk of cervical cancer in a Chinese population.
26451724 2015 Role of IL-17 Variants in Preeclampsia in Chinese Han Women.
26447633 2015 Influence of the IL17A and IL17F gene polymorphisms on the long-term kidney allograft function and return to dialysis after kidney transplantation.
26445528 2015 The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis.
More...