Property Summary

NCBI Gene PubMed Count 160
PubMed Score 347.95
PubTator Score 907.80

Knowledge Summary

Patent

No data available

Gene RIF (162)

AA Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSM      1 - 70
SRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS     71 - 140
FQLEKVLVTVGCTCVTPVIHHVQ                                                   141 - 163
//

Text Mined References (163)

PMID Year Title