Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
Funding $3,034,053.85
PubMed Score 21.32
PubTator Score 16.37

Knowledge Summary

Patent (3,260)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760608 Down-Regulation of OXGR1 through DNA Methylation is associated with hepatocellular carcinoma.
15001573 P2Y15 is a cell surface receptor for AMP and adenosine

AA Sequence

MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTI      1 - 70
IMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMS     71 - 140
CFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLP    141 - 210
LVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQI    211 - 280
HEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP                 281 - 337
//

Text Mined References (15)

PMID Year Title
27324180 2016 Expression and localization of GPR99 in human nasal mucosa.
23200873 2013 A novel model of spontaneous otitis media with effusion (OME) in the Oxgr1 knock-out mouse.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19760608 2009 Aberrant DNA methylation profile and frequent methylation of KLK10 and OXGR1 genes in hepatocellular carcinoma.
18404396 2004 The fate of P2Y-related orphan receptors: GPR80/99 and GPR91 are receptors of dicarboxylic acids.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15629198 2005 The recently deorphanized GPR80 (GPR99) proposed to be the P2Y15 receptor is not a genuine P2Y receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15141213 2004 Citric acid cycle intermediates as ligands for orphan G-protein-coupled receptors.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...