Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.16
PubTator Score 0.51

Knowledge Summary

Patent (4,092)

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.002
pancreatic cancer 1.200 0.007
osteosarcoma 1.448 0.040
glioblastoma 2.100 0.008
interstitial cystitis 1.400 0.018
adult high grade glioma 2.300 0.000
pilocytic astrocytoma 2.000 0.000
primary Sjogren syndrome 1.300 0.010
pancreatic carcinoma 1.200 0.007
nasopharyngeal carcinoma -1.300 0.012

AA Sequence

MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPF      1 - 70
MSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYG     71 - 140
HLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLCYNRQMELGAMISQIAGLIGTTFI    141 - 210
GFSFLVVLTSYYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDN    211 - 280
CQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG                  281 - 336
//

Text Mined References (7)

PMID Year Title
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.