Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.16
PubTator Score 0.51

Knowledge Summary

Patent (4,092)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 2.300 3.0e-04
Astrocytoma, Pilocytic 2.000 1.3e-04
glioblastoma 1.900 1.6e-04
hepatocellular carcinoma 1.200 2.4e-03
interstitial cystitis 1.400 1.8e-02
nasopharyngeal carcinoma -1.300 1.2e-02
osteosarcoma 1.448 4.0e-02
pancreatic cancer 1.200 6.5e-03
pancreatic carcinoma 1.200 6.5e-03
primary Sjogren syndrome 1.300 9.7e-03

AA Sequence

MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPF      1 - 70
MSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYG     71 - 140
HLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLCYNRQMELGAMISQIAGLIGTTFI    141 - 210
GFSFLVVLTSYYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDN    211 - 280
CQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG                  281 - 336
//

Text Mined References (7)

PMID Year Title