Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.75
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96P63 Q3SYB4
Symbols YUKOPIN

Gene

Gene RIF (2)

PMID Text
26497600 SERPINB12 formed a covalent complex with GZMA and inhibited the enzyme with typical serpin slow-binding kinetics. SERPINB12 also inhibited Hepsin. SERPINB12 may function as an endogenous inhibitor of these peptidases.
26220980 data suggest that SERPINB12, like some other intracellular serpins, may play a vital role in barrier function by providing protection of epithelial cells.

AA Sequence

MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHFNEFSQNESKE      1 - 70
PDPCLKSNKQKAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYGEQEFPICQEYLDGVIQFYHT     71 - 140
TIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAINAETVLVLVNAVYFKAKWETYFDHENTVDAP    141 - 210
FCLNANENKSVKMMTQKGLYRIGFIEEVKAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEK    211 - 280
MVAWSSSENMSEESVVLSFPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFV    281 - 350
EVDENGTQAAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP                   351 - 405
//

Text Mined References (8)

PMID Year Title
26497600 2015 SERPINB12 Is a Slow-Binding Inhibitor of Granzyme A and Hepsin.
26220980 2015 Human SERPINB12 Is an Abundant Intracellular Serpin Expressed in Most Surface and Glandular Epithelia.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11604408 2001 SERPINB12 is a novel member of the human ov-serpin family that is widely expressed and inhibits trypsin-like serine proteinases.