Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.17
PubTator Score 28.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.700 1.6e-02
astrocytoma -1.300 1.2e-16
Astrocytoma, Pilocytic -1.200 1.7e-02
atypical teratoid / rhabdoid tumor -1.300 9.0e-04
breast carcinoma 1.200 4.1e-02
ependymoma -1.400 4.7e-05
glioblastoma -1.300 4.2e-03
medulloblastoma -1.100 4.0e-08
oligodendroglioma -1.400 2.6e-18
osteosarcoma 1.154 3.0e-05
primitive neuroectodermal tumor -1.400 4.2e-04
subependymal giant cell astrocytoma -2.414 1.1e-02

Gene RIF (2)

AA Sequence

MNFQAGGGQSPQQQQQLAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHV      1 - 70
ISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL     71 - 140
LIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVI    141 - 210
DDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASI    211 - 280
PAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDRE    281 - 350
KKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLL    351 - 420
RTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPE    421 - 490
GLHQRSCSVSSADQWSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGP    491 - 560
SSATEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQNAALAVQ    561 - 630
AVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNA    631 - 700
LANSVWEGALGGYSKPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLA    701 - 770
HGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQ    771 - 840
HGCPGEGCGLAPTPNREPANGTNPSAELHRSPSLL                                       841 - 875
//

Text Mined References (17)

PMID Year Title