Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.15
PubTator Score 5.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q96P16 A8KA42 B2RBA3 Q7Z5G8 Q96FY9 Q9NVL4
Symbols P15RS
HsT3101

Gene

PDB

4JXT   4NAC  

Gene RIF (5)

PMID Text
25697359 Data suggest that p15RS (p15INK4b-related sequence) acts as an intrinsic transcriptional repressor for Wnt/beta-catenin-mediated gene transcription through recruiting HDAC2 histone deacetylase.
24997600 RPRD1A and RPRD1B associate directly with RPAP2 phosphatase and coordinate the dephosphorylation of RNAPII phospho-S5 by RPAP2.
22580456 The p15RS expression specifically downregulates the expression of cathepsin B and MMP-9 at RNA levels, which are known to promote cell invasion through degrading extracellular matrix proteins.
20739273 p15RS inhibits Wnt signaling by interrupting beta-catenin.TCF4 complex formation and that Wnt signaling initiates downstream gene expression by removing p15RS from promoters.
12470661 molecular cloning and characterization of P15RS, a novel P15(INK4b) related gene involved in G1/S progression

AA Sequence

MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS      1 - 70
KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY     71 - 140
EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE    141 - 210
RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR    211 - 280
SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED                                          281 - 312
//

Text Mined References (16)

PMID Year Title
25697359 2015 p15RS/RPRD1A (p15INK4b-related sequence/regulation of nuclear pre-mRNA domain-containing protein 1A) interacts with HDAC2 in inhibition of the Wnt/?-catenin signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24997600 2014 RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22580456 2012 Cellular and molecular evidence for malignancy-inhibitory functions of p15RS.
22231121 Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.
21269460 2011 Initial characterization of the human central proteome.
20739273 2010 p15RS attenuates Wnt/{beta}-catenin signaling by disrupting {beta}-catenin·TCF4 Interaction.
More...