Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.54
PubTator Score 5.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 3.5e-03
aldosterone-producing adenoma -1.131 1.2e-02
atypical teratoid / rhabdoid tumor -1.100 5.8e-04
Breast cancer 2.900 2.3e-02
cystic fibrosis 1.032 1.5e-04
glioblastoma -1.300 8.0e-04
hereditary spastic paraplegia -1.127 5.3e-03
invasive ductal carcinoma 1.100 5.6e-03
lung cancer 1.900 6.9e-03
non-small cell lung cancer 1.087 6.0e-14
oligodendroglioma 1.400 1.0e-02
osteosarcoma 1.859 1.5e-03
ovarian cancer -1.200 7.7e-04
pancreatic ductal adenocarcinoma liver m... -1.728 4.6e-02
psoriasis 2.100 2.4e-04
tuberculosis and treatment for 3 months -1.100 3.1e-04

Gene RIF (5)

AA Sequence

MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS      1 - 70
KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY     71 - 140
EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE    141 - 210
RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR    211 - 280
SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED                                          281 - 312
//

Text Mined References (17)

PMID Year Title