Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96NR7
Symbols C4orf38

Gene

 Compartment GO Term (0)

AA Sequence

MTSAETASRAAESGGTPVRPCSRPHRAPSPAAPSRPGAPAAGPRKLLVPGLPCLVRGGWPWTRPDSSPFR      1 - 70
PAARPRMSPHRSPAVARRCGRPRRRDPRRRRTPALPRPWPGRGGPGRSLLHRHLFIQQLLRTCWPALPRD     71 - 140
RTPAPGGTMPGAALAGPGRQASGSPAPQSEGAPPRPWTPLQPGLHHRPPSSSSGLLSSFF              141 - 200
//

Text Mined References (4)

PMID Year Title