Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.72
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 4.5e-03
Breast cancer -4.000 4.2e-20
breast carcinoma -1.500 6.2e-04
ependymoma -2.000 1.9e-05
group 3 medulloblastoma -2.300 1.2e-02
interstitial lung disease 1.200 2.6e-02
medulloblastoma, large-cell -2.200 1.2e-03
ovarian cancer -2.800 3.0e-07
Pick disease 1.500 4.1e-03
pituitary cancer -2.600 1.3e-05
progressive supranuclear palsy 1.100 1.5e-02
psoriasis -1.900 2.6e-33

Gene RIF (5)

AA Sequence

MLRQVLHRGLRTCFSRLGHFIASHPVFFASAPVLISILLGASFSRYQVEESVEHLLAPQHSLAKIERNLV      1 - 70
NSLFPVNRSKHRLYSDLQTPGRYGRVIVTSFQKANMLDQHHTDLILKLHAAVTKIQVPRPGFNYTFAHIC     71 - 140
ILNNDKTCIVDDIVHVLEELKNARATNRTNFAITYPITHLKDGRAVYNGHQLGGVTVHSKDRVKSAEAIQ    141 - 210
LTYYLQSINSLNDMVAERWESSFCDTVRLFQKSNSKVKMYPYTSSSLREDFQKTSRVSERYLVTSLILVV    211 - 280
TMAILCCSMQDCVRSKPWLGLLGLVTISLATLTAAGIINLTGGKYNSTFLGVPFVMLGHGLYGTFEMLSS    281 - 350
WRKTREDQHVKERTAAVYADSMLSFSLTTAMYLVTFGIGASPFTNIEAARIFCCNSCIAIFFNYLYVLSF    351 - 420
YGSSLVFTGYIENNYQHSIFCRKVPKPEALQEKPAWYRFLLTARFSEDTAEGEEANTYESHLLVCFLKRY    421 - 490
YCDWITNTYVKPFVVLFYLIYISFALMGYLQVSEGSDLSNIVATATQTIEYTTAQQKYFSNYSPVIGFYI    491 - 560
YESIEYWNTSVQEDVLEYTKGFVRISWFESYLNYLRKLNVSTGLPKKNFTDMLRNSFLKAPQFSHFQEDI    561 - 630
IFSKKYNDEVDVVASRMFLVAKTMETNREELYDLLETLRRLSVTSKVKFIVFNPSFVYMDRYASSLGAPL    631 - 700
HNSCISALFLLFFSAFLVADSLINVWITLTVVSVEFGVIGFMTLWKVELDCISVLCLIYGINYTIDNCAP    701 - 770
MLSTFVLGKDFTRTKWVKNALEVHGVAILQSYLCYIVGLIPLAAVPSNLTCTLFRCLFLIAFVTFFHCFA    771 - 840
ILPVILTFLPPSKKKRKEKKNPENREEIECVEMVDIDSTRVVDQITTV                          841 - 888
//

Text Mined References (11)

PMID Year Title