Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.94689276909862E-9
pilocytic astrocytoma 3086 9.33206694450886E-6
glioblastoma 5572 3.45347142557513E-5
atypical teratoid / rhabdoid tumor 4369 6.99178290338926E-5
primitive neuroectodermal tumor 3031 1.50877250642252E-4
ovarian cancer 8492 1.66347124926165E-4
adult high grade glioma 2148 9.29322547444063E-4
medulloblastoma 1524 0.00110781119624858
medulloblastoma, large-cell 6234 0.00825437286323507
Disease Target Count Z-score Confidence
Hypospadias 65 3.608 1.8

Expression

  Differential Expression (9)

Synonym

Accession Q96NL3 Q569K0 Q5PRG1
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

AA Sequence

MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYLLEHGQELWTV      1 - 70
KRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQARDEEKLIKIQEGNLRPGTN     71 - 140
PHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECDSQGPGKDPMTDARNNPYTCTECGKGFSK    141 - 210
KWALVRHQQIHAGVKPYECNECGKACRYMADVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGD    211 - 280
KPYECKECGKAFTHRSSFIQHNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTH    281 - 350
RSTFIQHNVTHTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGE    351 - 420
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLECKECAKAFYY    421 - 490
SSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKECEKAFCDNFALTQHMRTHTGE    491 - 560
KPFECNECGKTFSHSSSFTHHRKIHTRV                                              561 - 588
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21076407 2010 A de novo paradigm for mental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.