Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 9.3e-04
Astrocytoma, Pilocytic 1.100 1.3e-05
atypical teratoid / rhabdoid tumor 1.400 7.0e-05
ependymoma 1.500 4.9e-10
glioblastoma 1.300 3.5e-05
group 3 medulloblastoma 1.200 9.3e-03
medulloblastoma, large-cell 1.100 8.3e-03
ovarian cancer -1.500 1.7e-04
primitive neuroectodermal tumor 1.200 4.1e-03

AA Sequence

MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYLLEHGQELWTV      1 - 70
KRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQARDEEKLIKIQEGNLRPGTN     71 - 140
PHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECDSQGPGKDPMTDARNNPYTCTECGKGFSK    141 - 210
KWALVRHQQIHAGVKPYECNECGKACRYMADVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGD    211 - 280
KPYECKECGKAFTHRSSFIQHNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTH    281 - 350
RSTFIQHNVTHTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGE    351 - 420
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLECKECAKAFYY    421 - 490
SSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKECEKAFCDNFALTQHMRTHTGE    491 - 560
KPFECNECGKTFSHSSSFTHHRKIHTRV                                              561 - 588
//

Text Mined References (5)

PMID Year Title