Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.300 1.6e-02
Breast cancer 3.400 2.5e-02
intraductal papillary-mucinous carcinoma... -1.300 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.2e-02
osteosarcoma -1.948 6.4e-05
ovarian cancer -1.400 4.6e-06

AA Sequence

MAVGLLKAMYQELVTFRDVAVDFSQEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKPSVILLLEQGK      1 - 70
APWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTSYNLEYSSLREEWKCEGYFERQPG     71 - 140
NQKACFKEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQKIIPKEEKVHKHDTQKRSFKKNLMAIKPKS    141 - 210
VCAEKKLLKCNDCEKVFSQSSSLTLHQRIHTGEKPYKCIECGKAFSQRSNLVQHQRIHTGEKPYECKECR    211 - 280
KAFSQNAHLVQHLRVHTGEKPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQR    281 - 350
VHTGEKPYECNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQECR    351 - 420
KAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQRVHTGEKPYECTVCGKAFSYCGSLAQHQR    421 - 490
IHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQVL                            491 - 536
//

Text Mined References (7)

PMID Year Title