Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sideroblastic anemia 20 4.066 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.4e-06
group 3 medulloblastoma 1.100 9.7e-05
invasive ductal carcinoma 1.100 2.2e-03
medulloblastoma, large-cell 1.500 2.4e-04
osteosarcoma -1.847 1.8e-06

Gene RIF (3)

AA Sequence

MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYA      1 - 70
KKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGFMLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASP     71 - 140
TSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLVGRWVPFAAVAAANCVNIPMMRQQELIKGICVKDRN    141 - 210
ENEIGHSRRAAAIGITQVVISRITMSAPGMILLPVIMERLEKLHFMQKVKVLHAPLQVMLSGCFLIFMVP    211 - 280
VACGLFPQKCELPVSYLEPKLQDTIKAKYGELEPYVYFNKGL                                281 - 322
//

Text Mined References (15)

PMID Year Title