Property Summary

NCBI Gene PubMed Count 10
PubMed Score 50.76
PubTator Score 46.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.004
group 3 medulloblastoma 1.300 0.009
acute myeloid leukemia -1.300 0.033
ovarian cancer -1.100 0.011

Synonym

Accession Q96NB1 B3KPU9
Symbols FOR20
C16orf63
PHSECRG2

Gene

Gene RIF (2)

PMID Text
24018379 The depletion of FOR20 (FOP-related protein of 20 kDa), a conserved centrosomal protein, inhibits S-phase progression and prevents targeting of Plk1 (polo-like kinase 1) to centrosomes, where FOR20 interacts with Plk1.
19843651 Microdeletions at 16p13.11 are associated with a predisposition to idiopathic generalized epilepsy.

AA Sequence

MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTA      1 - 70
SVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLG     71 - 140
RQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR                                        141 - 174
//

Text Mined References (11)

PMID Year Title
24018379 2013 Centrosomal protein FOR20 is essential for S-phase progression by recruiting Plk1 to centrosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20551181 2010 Control of ciliogenesis by FOR20, a novel centrosome and pericentriolar satellite protein.
19843651 2010 Recurrent microdeletions at 15q11.2 and 16p13.11 predispose to idiopathic generalized epilepsies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...