Property Summary

NCBI Gene PubMed Count 12
PubMed Score 57.33
PubTator Score 46.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 4.1e-03
group 3 medulloblastoma 4104 8.6e-03
ovarian cancer 8520 1.1e-02
acute myeloid leukemia 783 3.3e-02
Disease Target Count Z-score Confidence
Angular cheilitis 4 3.944 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.300 3.3e-02
group 3 medulloblastoma 1.300 8.6e-03
medulloblastoma, large-cell 1.200 4.1e-03
ovarian cancer -1.100 1.1e-02

Gene RIF (4)

AA Sequence

MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTA      1 - 70
SVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLG     71 - 140
RQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR                                        141 - 174
//

Text Mined References (14)

PMID Year Title