Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.7e-05
adrenocortical carcinoma 1428 5.9e-04
invasive ductal carcinoma 2951 9.7e-04
group 3 medulloblastoma 4104 2.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.180 5.9e-04
group 3 medulloblastoma 1.100 2.8e-03
invasive ductal carcinoma 1.200 9.7e-04
osteosarcoma -1.742 3.7e-05

AA Sequence

MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPT      1 - 70
GLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTW     71 - 140
KQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDLNKHLTT    141 - 210
HQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRR    211 - 280
NFSRRSSLLRHQKLHL                                                          281 - 296
//

Text Mined References (7)

PMID Year Title