Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.03
PubTator Score 7.71

Knowledge Summary

Patent (15,868)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-05
psoriasis 6694 1.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.846 1.9e-05
psoriasis 1.700 1.2e-04

Gene RIF (7)

AA Sequence

MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQTVFLALCLLWA      1 - 70
ALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQVVFKAKVKRRPEMSRGLLAVR     71 - 140
GAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSDSLFVICALSLAACLCLVARRAPSTSIYLEA    141 - 210
KGTSVCQAAAMGGAMVLLYASRACYNLTALALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLIL    211 - 280
FVWELLPTTLLVGFFRVHRPPQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAA    281 - 350
TTTVSTPPHRRDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP       351 - 417
//

Text Mined References (14)

PMID Year Title