Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.04
PubTator Score 7.71

Knowledge Summary

Patent (15,868)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.846 0.000

Gene RIF (6)

PMID Text
25524330 GPR137 knockdown inhibited growth of Daoy medulloblastoma cells via disturbing cell cycle progression and inducing apoptosis
25496438 GPR137 as an essential player in urinary bladder cancer cell growth
25490967 Knockdown of GPR137 in HepG2 cells led to cell cycle arrest at G0/G1 phase and G2/M phase, and induced cell apoptosis, as determined by flow cytometry analysis, which contributed to cell growth inhibition.
25471990 GPR137 as a potential oncogene in pancreatic cancer cells
25301753 Expression levels of GRP137 were analyzed in different colon cancer cell lines. Silencing of GPR137 reduced the proliferation rate and colony numbers.
24870220 Our results indicated that GPR137 is involved in the progression of human glioma

AA Sequence

MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQTVFLALCLLWA      1 - 70
ALRTTLFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQVVFKAKVKRRPEMSRGLLAVR     71 - 140
GAFVGASLLFLLVNVLCAVLSHRRRAQPWALLLVRVLVSDSLFVICALSLAACLCLVARRAPSTSIYLEA    141 - 210
KGTSVCQAAAMGGAMVLLYASRACYNLTALALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLIL    211 - 280
FVWELLPTTLLVGFFRVHRPPQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAA    281 - 350
TTTVSTPPHRRDPPPSPTEYPGPSPPHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP       351 - 417
//

Text Mined References (13)

PMID Year Title
25524330 Inhibition of GPR137 suppresses proliferation of medulloblastoma cells in vitro.
25496438 G-protein-coupled receptor 137 accelerates proliferation of urinary bladder cancer cells in vitro.
25490967 2015 Down-regulation of G protein-coupled receptor 137 by RNA interference inhibits cell growth of two hepatoma cell lines.
25471990 Knockdown of GPR137 by RNAi inhibits pancreatic cancer cell growth and induces apoptosis.
25301753 2014 Down-regulation of GPR137 expression inhibits proliferation of colon cancer cells.
24870220 2014 Inhibition of GPR137 expression reduces the proliferation and colony formation of malignant glioma cells.
22837380 2012 A novel sarcoidosis risk locus for Europeans on chromosome 11q13.1.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...