Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
Funding $92,934
PubMed Score 11.24
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.004
ependymoma -2.900 0.007
oligodendroglioma -2.100 0.016
glioblastoma -3.200 0.000
medulloblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -2.500 0.001
primitive neuroectodermal tumor -3.300 0.000
tuberculosis 2.000 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -3.600 0.000
pituitary cancer -1.600 0.002
psoriasis 1.900 0.000

Synonym

Accession Q96N16 A6H2J2 A6H2J3 A6H2J4 A6H2J5 A8MTK6 B4DHZ8 B8ZZR7 D3DVT0 Q86Y69 Q8N7G3
Symbols JAMIP1
MARLIN1
Gababrbp

Gene

Gene RIF (7)

PMID Text
23481296 JAKMIP1 associates with and possibly contributes to the Wnt/beta-catenin pathway activity through its influence on downstream Wnt target proteins, including beta-catenin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18941173 Jakmip1 is a novel effector memory gene that restrains T cell-mediated cytotoxicity.
17804789 Observational study of gene-disease association. (HuGE Navigator)
17761393 We have identified four new transcripts of 2975 bp, 1743 bp, 2189 bp and 2420 bp respectively, named Jakmip1B, Jakmip1C, Jakmip1D and Jakmip1E
15277531 Marlin1 has a role in cell polarization, segregation of signaling complexes, and vesicle traffic, some of which may involve Jak tyrosine kinases
14718537 Marlin-1 functions to regulate the cellular levels of GABA(B) R2 subunits, which may have significant effects on the production of functional GABA(B) receptor heterodimers

AA Sequence

MSKKGRSKGEKPEMETDAVQMANEELRAKLTSIQIEFQQEKSKVGKLRERLQEAKLEREQEQRRHTAYIS      1 - 70
ELKAKLHEEKTKELQALREGLIRQHEQEAARTAKIKEGELQRLQATLNVLRDGAADKVKTALLTEAREEA     71 - 140
RRAFDGERLRLQQEILELKAARKQAEEALSNCMQADKTKAADLRAAYQAHQDEVHRIKRECERDIRRLMD    141 - 210
EIKGKDRVILALEKELGVQAGQTQKLLLQKEALDEQLVQVKEAERHHSSPKRELPPGIGDMVELMGVQDQ    211 - 280
HMDERDVRRFQLKIAELNSVIRKLEDRNTLLADERNELLKRSRETEVQLKPLVEKNKRMNKKNEDLLQSI    281 - 350
QRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSLERERLL    351 - 420
RSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTDRTDRTPATPEEDLDDATAREEADLRFCQ    421 - 490
LTREYQALQRAYALLQEQVGGTLDAEREARTREQLQADLLRCQAKIEDLEKLLVEKGQDSKWVEEKQLLI    491 - 560
RTNQDLLEKIYRLEMEENQLKNEMQDAKDQNELLEFRVLELEVRDSICCKLSNGADILFEPKLKFM        561 - 626
//

Text Mined References (21)

PMID Year Title
23481296 2013 Overexpression of JAKMIP1 associates with Wnt/?-catenin pathway activation and promotes cancer cell proliferation in vitro.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18941173 2008 Jakmip1 is expressed upon T cell differentiation and has an inhibitory function in cytotoxic T lymphocytes.
17804789 2007 Genome-wide association study for Crohn's disease in the Quebec Founder Population identifies multiple validated disease loci.
17761393 2007 Identification and expression analysis of novel Jakmip1 transcripts.
17572408 2007 Identification and characterization of two novel (neuro)endocrine long coiled-coil proteins.
17532644 2007 Marlin-1 and conventional kinesin link GABAB receptors to the cytoskeleton and regulate receptor transport.
More...