Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.40
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.98080629974556E-5
osteosarcoma 7933 1.98898094512126E-5
ovarian cancer 8492 1.24628211905911E-4
interstitial cystitis 2299 1.97863688847135E-4
urothelial carcinoma 318 2.3038810758593E-4
medulloblastoma, large-cell 6234 4.81162213232977E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0013572860033161
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00140976015691835
oligodendroglioma 2849 0.00248736598281856
astrocytic glioma 2241 0.00252518242716326
ependymoma 2514 0.00402922959140385
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.013512884692002
Disease Target Count Z-score Confidence
Lymphangioleiomyomatosis 17 3.201 1.6
Retinitis pigmentosa 156 3.176 1.6

Expression

Synonym

Accession Q96MY7 B7Z882 J3KNA2
Symbols C14orf44
c14_5547

Gene

  Ortholog (11)

AA Sequence

MTVGRPEGAPGGAEGSRQIFPPESFADTEAGEELSGDGLVLPRASKLDEFLSPEEEIDSTSDSTGSIYQN      1 - 70
LQELKQKGRWCLLESLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQCPQALRCGSTRRCSSLNNLPS     71 - 140
NIPRPQTQPPSGSRPPSQHRSVSSWASSITVPRPFRMTLREARKKAEWLGSPASFEQERQRAQRQGEEEA    141 - 210
ECHRQFRAQPVPAHVYLPLYQEIMERSEARRQAGIQKRKELLLSSLKPFSFLEKEEQLKEAARQRDLAAT    211 - 280
AEAKISKQKATRRIPKSILEPALGDKLQEAELFRKIRIQMRALDMLQMASSPIASSSNRANPQPRTATRT    281 - 350
QQEKLGFLHTNFRFQPRVNPVVPDYEGLYKAFQRRAAKRRETQEATRNKPFLLRTANLRHPQRPCDAATT    351 - 420
GRRQDSPQPPATPLPRSRSLSGLASLSANTLPVHITDATRKRESAVRSALEKKNKADESIQWLEIHKKKS    421 - 490
QAMSKSVTLRAKAMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQVAKDLAKK    491 - 560
EAEQWYLDTLKQAGLEEDFVRNKGQGTRAVQEKETKIKDFPRFQETTKLSIRDPEQGLEGSLEQPASPRK    561 - 630
VLEELSHQSPENLVSLA                                                         631 - 647
//

Text Mined References (6)

PMID Year Title
22791751 2012 The retinitis pigmentosa 28 protein FAM161A is a novel ciliary protein involved in intermolecular protein interaction and microtubule association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.