Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
astrocytic glioma 2597 4.5e-02

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.200 4.5e-02

Gene RIF (1)

AA Sequence

MAAPSEVAAIAPGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDALQGILSAFLEE      1 - 70
DSLLNICKEIVERWSETQNVVTKVKKEDEVQAIATLIEKQAQIVVKPRMVSEEEKQRKAALLAQYADVTD     71 - 140
EEDEADEKDDSGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERK    141 - 210
EKEKKRTQRGERKR                                                            211 - 224
//

Text Mined References (14)

PMID Year Title