Property Summary

NCBI Gene PubMed Count 34
Grant Count 31
R01 Count 24
Funding $4,465,257.94
PubMed Score 40.86
PubTator Score 8.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.800 0.001
osteosarcoma -1.473 0.000
lung cancer 1.700 0.046
Breast cancer 2.200 0.027
ovarian cancer 1.300 0.001

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26400686 CEP63 is particularly important for brain development and might control the proliferation and migration of cells when those two events need to be highly coordinated.
25643699 centrosomal Cdk1 signals were strongly diminished in cells treated with Cep63 siRNA when sc-54 was used for Cdk1 labeling
23936128 both mouse and human Cep63 and Cep152 cooperate to ensure efficient centriole duplication by promoting the accumulation of essential centriole duplication factors upstream of SAS-6 recruitment and procentriole formation.
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
22555018 One new SNP (rs112926188) in CEP63O was reported. Analysis showed that rs112926188 allele substituting proline at the 61st residue position of CEP63 produced more flexibility in three-deimensional space.
21406398 Findings define Cep63 as a centrosomal recruitment factor for Cdk1 that is essential for mitotic entry, providing a physical link between the centrosome and the cell-cycle machinery.
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
16410684 CEP63 transcripts exhibited three different expression patterns, downregulation was found in about 50% of the cases analyzed and CEP63 gene transcription was associated with invasive tumors.

AA Sequence

MEALLEGIQNRGHGGGFLTSCEAELQELMKQIDIMVAHKKSEWEGRTHALETCLKIREQELKSLRSQLDV      1 - 70
THKEVGMLHQQVEEHEKIKQEMTMEYKQELKKLHEELCILKRSYEKLQKKQMREFRGNTKNHREDRSEIE     71 - 140
RLTAKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEIIQAQLVNRKQKLESVELSSQSEIQHLS    141 - 210
SKLERANDTICANELEIERLTMRVNDLVGTSMTVLQEQQQKEEKLRESEKLLEALQEEKRELKAALQSQE    211 - 280
NLIHEARIQKEKLQEKVKATNTQHAVEAIRPREESLAEKKYTSQGQGDLDSVLSQLNFTHTSEDLLQAEV    281 - 350
TCLEGSLESVSATCKQLSQELMEKYEELKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHL    351 - 420
TQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESLKLENRHLSEMVMKLELGLHEA    421 - 490
KEISLADLQENYIEALNKLVSENQQLQKDLMNTKSQLEISTQMCKKQNDRIFKPTHSRTTEFKNTEFKPT    491 - 560
HGQHRHDGIKTEHYKTDLHSPRGQASDSINPMSRVLSPLSPQISPCSSTRSLTSYSLCKTHSLPSALDTN    561 - 630
EANFSDTMSESMNDQEEFISSCSLPVSPLGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFT    631 - 700
ALK                                                                       701 - 703
//

Text Mined References (37)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26400686 2015 Mutation in CEP63 co-segregating with developmental dyslexia in a Swedish family.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25643699 2015 Cep63 recruits cdk1 to the centrosome-letter.
25416956 2014 A proteome-scale map of the human interactome network.
24613305 2014 Proximity interactions among centrosome components identify regulators of centriole duplication.
24240477 2013 The Cep63 paralogue Deup1 enables massive de novo centriole biogenesis for vertebrate multiciliogenesis.
23936128 2013 Cep63 and cep152 cooperate to ensure centriole duplication.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...