Property Summary

NCBI Gene PubMed Count 36
PubMed Score 45.60
PubTator Score 8.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Microcephaly 166 6.658 3.3
Disease Target Count P-value
malignant mesothelioma 3232 2.1e-06
osteosarcoma 7950 2.8e-06
ovarian cancer 8520 1.0e-03
psoriasis 6694 8.1e-03
Breast cancer 3578 2.7e-02
lung cancer 4740 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Intellectual disability 1016 5.183 2.6
Disease Target Count
Seckel Syndrome 6 1

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.200 2.7e-02
lung cancer 1.700 4.6e-02
malignant mesothelioma 1.100 2.1e-06
osteosarcoma -1.473 2.8e-06
ovarian cancer 1.300 1.0e-03
psoriasis -1.100 8.1e-03

Gene RIF (10)

AA Sequence

MEALLEGIQNRGHGGGFLTSCEAELQELMKQIDIMVAHKKSEWEGRTHALETCLKIREQELKSLRSQLDV      1 - 70
THKEVGMLHQQVEEHEKIKQEMTMEYKQELKKLHEELCILKRSYEKLQKKQMREFRGNTKNHREDRSEIE     71 - 140
RLTAKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEIIQAQLVNRKQKLESVELSSQSEIQHLS    141 - 210
SKLERANDTICANELEIERLTMRVNDLVGTSMTVLQEQQQKEEKLRESEKLLEALQEEKRELKAALQSQE    211 - 280
NLIHEARIQKEKLQEKVKATNTQHAVEAIRPREESLAEKKYTSQGQGDLDSVLSQLNFTHTSEDLLQAEV    281 - 350
TCLEGSLESVSATCKQLSQELMEKYEELKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHL    351 - 420
TQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESLKLENRHLSEMVMKLELGLHEA    421 - 490
KEISLADLQENYIEALNKLVSENQQLQKDLMNTKSQLEISTQMCKKQNDRIFKPTHSRTTEFKNTEFKPT    491 - 560
HGQHRHDGIKTEHYKTDLHSPRGQASDSINPMSRVLSPLSPQISPCSSTRSLTSYSLCKTHSLPSALDTN    561 - 630
EANFSDTMSESMNDQEEFISSCSLPVSPLGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFT    631 - 700
ALK                                                                       701 - 703
//

Text Mined References (39)

PMID Year Title