Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.89
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.52202972284329E-86
ovarian cancer 8492 2.00235531447101E-8
glioblastoma 5572 4.98119552034377E-7
tuberculosis 1563 1.17064396080841E-6
sonic hedgehog group medulloblastoma 1482 3.82367947230078E-5
pituitary cancer 1972 5.07215458897145E-5
adult high grade glioma 2148 7.88600514774815E-5
osteosarcoma 7933 1.6623903677949E-4
ependymoma 2514 0.00172269010740711
oligodendroglioma 2849 0.00437041045458893
astrocytic glioma 2241 0.00463092725133698
primitive neuroectodermal tumor 3031 0.016938425585487
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0209701187829857
mucosa-associated lymphoid tissue lymphoma 480 0.0261390065755426
Disease Target Count Z-score Confidence
Nephrosis 18 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.900 0.005
ependymoma -2.300 0.002
oligodendroglioma -1.700 0.004
glioblastoma -1.700 0.000
osteosarcoma -2.970 0.000
primitive neuroectodermal tumor -1.100 0.017
pancreatic ductal adenocarcinoma liver m... -1.330 0.021
tuberculosis 1.600 0.000
adult high grade glioma -1.600 0.000
sonic hedgehog group medulloblastoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.950 0.026
ovarian cancer 1.200 0.000
pituitary cancer 1.300 0.000
psoriasis 1.600 0.000

Synonym

Accession Q96MS3 Q86XG8
Symbols

Gene

  Ortholog (9)

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
8218172 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2649653 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2341393 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2283726 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase

AA Sequence

MRLLFLAVLRPHTGNAVTAQRVRAHLEAAGHVCVLKDAFDFESRSEIANLILAENCEAALALHLYRGGRL      1 - 70
LQGHRIPFGVIFGGTDVNEDANQAEKNTVMGRVLEEARFAVAFTESMKEMAQAQWPHAKGKVYVQSQGIA     71 - 140
TTPNAAFNWNTFLQRSEINQSADNLHIFLLICGLRQVKDPLYLVDAFSAWHQEEPNVHLVIVGPEVDPVF    141 - 210
TREVKAKVKRAAGVRLIGEMPQEDLHAVVKNCFAVVNSSVSEGMSAAILEAMDLEVPVLARNIPGNAAVV    211 - 280
KHEVTGLLFSNPQEFVHLAKRLVSDPALEKEIVVNGREYVRMYHSWQVERDTYQQLIRKLEGSTED        281 - 346
//

Text Mined References (7)

PMID Year Title
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.