Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.89
PubTator Score 0.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 7.9e-05
astrocytic glioma -1.900 4.6e-03
ependymoma -2.300 1.7e-03
glioblastoma -1.700 5.0e-07
mucosa-associated lymphoid tissue lympho... 1.950 2.6e-02
oligodendroglioma -1.700 4.4e-03
osteosarcoma -2.970 1.7e-04
ovarian cancer 1.200 2.0e-08
pancreatic ductal adenocarcinoma liver m... -1.330 2.1e-02
pituitary cancer 1.300 5.1e-05
primitive neuroectodermal tumor -1.100 1.7e-02
psoriasis 1.600 3.5e-86
sonic hedgehog group medulloblastoma -1.400 3.8e-05
tuberculosis 1.600 1.2e-06

Gene RIF (5)

AA Sequence

MRLLFLAVLRPHTGNAVTAQRVRAHLEAAGHVCVLKDAFDFESRSEIANLILAENCEAALALHLYRGGRL      1 - 70
LQGHRIPFGVIFGGTDVNEDANQAEKNTVMGRVLEEARFAVAFTESMKEMAQAQWPHAKGKVYVQSQGIA     71 - 140
TTPNAAFNWNTFLQRSEINQSADNLHIFLLICGLRQVKDPLYLVDAFSAWHQEEPNVHLVIVGPEVDPVF    141 - 210
TREVKAKVKRAAGVRLIGEMPQEDLHAVVKNCFAVVNSSVSEGMSAAILEAMDLEVPVLARNIPGNAAVV    211 - 280
KHEVTGLLFSNPQEFVHLAKRLVSDPALEKEIVVNGREYVRMYHSWQVERDTYQQLIRKLEGSTED        281 - 346
//

Text Mined References (7)

PMID Year Title