Property Summary

NCBI Gene PubMed Count 21
Grant Count 42
R01 Count 36
Funding $4,896,126.29
PubMed Score 85.65
PubTator Score 44.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
group 3 medulloblastoma 3.200 0.000
lung cancer 1.800 0.000
breast carcinoma -1.400 0.000
non-inflammatory breast cancer -2.200 0.000
ductal carcinoma in situ -1.100 0.000
invasive ductal carcinoma -1.100 0.002
ovarian cancer -1.900 0.000

Gene RIF (20)

PMID Text
26070964 confirmed that ROBO3 increases with clinical grade and miR-383 expression is inversely correlated to that of ROBO3
25882844 human AKAP79-anchored PKC selectively phosphorylates the Robo3.1 receptor subtype on serine 1330
24969490 We report the case of a 10-month-old girl with cross-fixation and inability to abduct who was genetically proven to have horizontal gaze palsy with progressive scoliosis (recessive ROBO3 mutations).
24936616 Robo3.1A may prevent the Slit responsiveness by recruiting Robo1/2 into a late endosome- and lysosome-dependent degradation pathway.
21850172 Three novel ROBO3 mutations have been identified in consanguineous patients with horizontal gaze palsy and progressive scoliosis.
21592015 The novel ROBO3 mutation in this family may be among the most deleterious
21510772 This patient had clinical and neuroimaging characteristics considered pathognomonic of horizontal gaze palsy and progressive scoliosis and yet did not have ROBO3 mutations
21187438 RIG-I or melanoma differentiation-associated gene (MDA)5 signaling through mitochondrial antiviral signaling protein MAVS is required for activation of interferon (IFN)-beta production by rotavirus-infected intestinal epithelial cells.
20298552 Slit3 inhibits Robo3-induced invasion of synovial fibroblasts in rheumatoid arthritis.
19041479 This is the second reported patient with synergistic convergence and the first associated with a documented pathologic genotype.
More...

AA Sequence

MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPEDAMPRIVEQP      1 - 70
PDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPSGALFFPRIVHGRRARPDEGV     71 - 140
YTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVGEPAVLECVPPRGHPEPSVSWRKDGARLKEE    141 - 210
EGRITIRGGKLMMSHTLKSDAGMYVCVASNMAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCE    211 - 280
VKGDPPPRLRWRKEDGELPTGRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLV    281 - 350
TQPQDQMAAPGESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG    351 - 420
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQPSVRWKKDGQW    421 - 490
LQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMREDWGVSPDPPTEPSSPPGAPS    491 - 560
QPVVTEITKNSITLTWKPNPQTGAAVTSYVIEAFSPAAGNTWRTVADGVQLETHTVSGLQPNTIYLFLVR    561 - 630
AVGAWGLSEPSPVSEPVRTQDSSPSRPVEDPWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQ    631 - 700
GFRVSWRVAGPEGGSWTMLDLQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSG    701 - 770
PPQGVAVALGGDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL    771 - 840
YRTLVAAATSAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAACGALLLGLCA    841 - 910
ALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYSWLADSWPHPSRSPSAQEPRG    911 - 980
SCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQY    981 - 1050
APPEWSQGDSGAKGGKVKLLGKPVQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPER   1051 - 1120
SHLTEPSSSGGCLVTPSRRETPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSV   1121 - 1190
SQPMLGIREARPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR   1191 - 1260
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDEEAWLPYSRPS   1261 - 1330
FLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQKRREEPR                 1331 - 1386
//

Text Mined References (22)

PMID Year Title
26070964 2015 ROBO3 promotes growth and metastasis of pancreatic carcinoma.
25882844 2015 A-kinase Anchoring Protein 79/150 Recruits Protein Kinase C to Phosphorylate Roundabout Receptors.
24969490 2014 Infantile esotropia with cross-fixation, inability to abduct, and underlying horizontal gaze palsy with progressive scoliosis.
24936616 2014 Robo3.1A suppresses slit-mediated repulsion by triggering degradation of Robo2.
21850172 2011 Horizontal gaze palsy with progressive scoliosis: three novel ROBO3 mutations and descriptions of the phenotypes of four patients.
21592015 2011 Horizontal gaze palsy and progressive scoliosis due to a deleterious mutation in ROBO3.
21510772 2011 Horizontal gaze palsy and progressive scoliosis without ROBO3 mutations.
21187438 2011 RIG-I/MDA5/MAVS are required to signal a protective IFN response in rotavirus-infected intestinal epithelium.
20298552 2010 Slit3 inhibits Robo3-induced invasion of synovial fibroblasts in rheumatoid arthritis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...