Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.35
PubTator Score 15.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
AMELOGENESIS IMPERFECTA, TYPE IG 1 0.0 0.0
Arthritis, Juvenile 126 0.0 0.0

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.500 2.4e-02
head and neck cancer and chronic obstruc... 1.400 8.1e-03
interstitial cystitis 1.400 8.8e-03
intraductal papillary-mucinous adenoma (... 1.300 2.2e-02
invasive ductal carcinoma -1.082 1.5e-02
lung carcinoma -2.100 4.0e-20
medulloblastoma, large-cell 1.100 2.4e-04
non-small cell lung cancer -1.657 5.2e-11
osteosarcoma -1.552 2.7e-02
ovarian cancer -1.600 1.5e-04
pancreatic cancer 1.100 2.3e-02
pancreatic carcinoma 1.100 2.3e-02
pancreatic ductal adenocarcinoma liver m... -2.169 7.0e-04
pituitary cancer -1.500 2.8e-06
subependymal giant cell astrocytoma 1.317 1.4e-02
tuberculosis 1.500 4.1e-02

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHN      1 - 70
FSRTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMY     71 - 140
REQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACD    141 - 210
CTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPP    211 - 280
TVGRIVNVTKEILEVTKNEILQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLA    281 - 350
PRLSVPNPWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKF    351 - 420
GDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVL    421 - 490
TEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQLAPDSGQANLTS                       491 - 541
//

Text Mined References (23)

PMID Year Title