Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.17
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 3.8e-37
acute quadriplegic myopathy 1158 6.0e-08
osteosarcoma 7950 2.7e-05

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.978 6.0e-08
lung carcinoma 1.600 3.8e-37
osteosarcoma -1.203 2.7e-05

Gene RIF (11)

AA Sequence

MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSS      1 - 70
RSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPP     71 - 140
VMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFF    141 - 210
DEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT                                     211 - 247
//

Text Mined References (17)

PMID Year Title