Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.17
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.203 0.000
acute quadriplegic myopathy -1.978 0.000
lung carcinoma 1.600 0.000

Synonym

Gene

Gene RIF (10)

PMID Text
26768296 In conclusion, urinary CoQ analysis is a noninvasive, reliable, and reproducible method to determine urinary tract CoQ status.
26107394 Report age-related increase in oxidized proportion of muscle coenzyme Q10.
25800618 Effect of Coenzyme Q10 on Th1/Th2 Paradigm in Females with Idiopathic Recurrent Pregnancy Loss
25463064 Serum coenzyme Q10 levels were inversely associated with risk of disabling dementia.
23494902 When a childhood mitochondrial disorder is suspected, an increased frequency of type 2C fibers in morphologically normal muscle suggests CoQ10 deficiency.
22645453 coenzyme Q10, superoxide dismutase, and oxidative stress have roles in coronary artery disease, but the effect of malondialdehyde, catalase, and glutathione peroxidase is not significant
21640350 plasma coenzyme Q10, asymmetric dimethylarginine and arterial stiffness in patients have a role in phenotypic or genotypic familial hypercholesterolemia with long-term statin therapy
21458815 Rosuvastatin combined with regular exercise preserves coenzyme Q10 levels associated with a significant increase in high-density lipoprotein cholesterol in patients with coronary artery disease
20877624 Observational study of gene-disease association. (HuGE Navigator)
19891963 Results show no significant differences in paraoxonase, oxLDL, or other oxidative stress markers after 2 months of acetylsalicylic acid treatment.

AA Sequence

MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSS      1 - 70
RSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPP     71 - 140
VMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFF    141 - 210
DEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT                                     211 - 247
//

Text Mined References (16)

PMID Year Title
26768296 Determination of urinary coenzyme Q10 by HPLC with electrochemical detection: Reference values for a paediatric population.
26107394 2015 Oxidized proportion of muscle coenzyme Q10 increases with age in healthy children.
25800618 2015 Effect of Coenzyme Q10 on Th1/Th2 Paradigm in Females with Idiopathic Recurrent Pregnancy Loss.
25463064 2014 Serum coenzyme Q10 and risk of disabling dementia: the Circulatory Risk in Communities Study (CIRCS).
23494902 2013 Coenzyme Q10 deficiency in children: frequent type 2C muscle fibers with normal morphology.
22645453 2012 The relationship between coenzyme Q10, oxidative stress, and antioxidant enzymes activities and coronary artery disease.
21640350 2011 Relationship between plasma coenzyme Q10, asymmetric dimethylarginine and arterial stiffness in patients with phenotypic or genotypic familial hypercholesterolemia on long-term statin therapy.
21458815 2011 Rosuvastatin combined with regular exercise preserves coenzyme Q10 levels associated with a significant increase in high-density lipoprotein cholesterol in patients with coronary artery disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19891963 2010 Effects of acetylsalicylic acid on serum paraoxonase activity, Ox-LDL, coenzyme Q10 and other oxidative stress markers in healthy volunteers.
More...