Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00277461921270869

Expression

Synonym

Accession Q96MC9 Q5JTS5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQGNNLQPPSPRPLECWSLHREAPQRTEASRTHPSPFLALPGSHRTANQAQVVPGLVHHPQENTQRLRIR      1 - 70
AGLSPFPRARLAAIGSTHGHRWVPGICLPRCLCPASCALHACPPHCNNAEAHSWLRLGGPLQSRSVEHQQ     71 - 140
HACGWGWVTHATYGERGTSQAAERQRIAHTRALSVGNCPRSHFQCEFSSISKWSEGTGTFSPRPRAVKSG    141 - 210
VGGQPSPHIRITWRSCTTLTSKPCSRAITPECVVGWSRRSRHWYSDMRTGECQGLSPITR              211 - 270
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.