Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 2
Funding $1,163,527.5
PubMed Score 390.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
ependymoma -1.600 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.000 0.000
adult high grade glioma -1.600 0.000
lung carcinoma 2.000 0.000
invasive ductal carcinoma -1.100 0.007

AA Sequence

MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRR      1 - 70
ESELRFMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKIHKLVQKRDFLVDDAEVERLR     71 - 140
EQEEDKEMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM          141 - 204
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25099998 2014 The newly identified migration inhibitory protein regulates the radial migration in the developing neocortex.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.