Property Summary

NCBI Gene PubMed Count 8
PubMed Score 390.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.21645884882885E-28
ependymoma 2514 4.91968407291081E-12
malignant mesothelioma 3163 6.65254269298817E-7
atypical teratoid / rhabdoid tumor 4369 1.95493000283353E-6
adult high grade glioma 2148 4.86589114975021E-5
glioblastoma 5572 7.54380214594392E-5
medulloblastoma, large-cell 6234 1.52610711991557E-4
invasive ductal carcinoma 2950 0.00670603295194104
Disease Target Count Z-score Confidence
Lisch epithelial corneal dystrophy 4 3.794 1.9
Cancer 2346 3.436 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
ependymoma -1.600 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.000 0.000
adult high grade glioma -1.600 0.000
lung carcinoma 2.000 0.000
invasive ductal carcinoma -1.100 0.007

Synonym

Accession Q96MC5 O00223 O75769 Q8IZ36 Q96H25
Symbols MINP

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRR      1 - 70
ESELRFMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKIHKLVQKRDFLVDDAEVERLR     71 - 140
EQEEDKEMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM          141 - 204
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25099998 2014 The newly identified migration inhibitory protein regulates the radial migration in the developing neocortex.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.