Property Summary

NCBI Gene PubMed Count 8
PubMed Score 405.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.600 4.9e-05
atypical teratoid / rhabdoid tumor -2.300 2.0e-06
ependymoma -1.600 4.9e-12
glioblastoma -1.100 2.8e-05
invasive ductal carcinoma -1.100 6.7e-03
lung carcinoma 2.000 1.2e-28
malignant mesothelioma -1.800 6.7e-07
medulloblastoma, large-cell -2.000 1.5e-04

Synonym

Accession Q96MC5 O00223 O75769 Q8IZ36 Q96H25
Symbols MINP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRR      1 - 70
ESELRFMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKIHKLVQKRDFLVDDAEVERLR     71 - 140
EQEEDKEMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM          141 - 204
//

Text Mined References (8)

PMID Year Title